Property Summary

NCBI Gene PubMed Count 33
PubMed Score 62.56
PubTator Score 20.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
spina bifida -2.598 3.2e-02
acute myeloid leukemia 1.200 4.7e-02

Gene RIF (2)

PMID Text
25016529 Letter: report elevated ERV3-1 levels in colorectal neoplasms.
15081124 molecular evolution and comparison with other primates

AA Sequence

MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSV      1 - 70
CDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSM     71 - 140
EYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQP    141 - 210
IWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLA    211 - 280
ENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWG    281 - 350
KAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEAPNTWQAPSGLYWI    351 - 420
CGPQAYRQLPAKWSGACVLGTIRPSFFLMPLKQGEALGYPIYDETKRKSKRGITIGDWKDNEWPPERIIQ    421 - 490
YYGPATWAEDGMWGYRTPVYMLNRIIRLQAVLEIITNETAGALNLLAQQATKMRNVIYQNRLALDYLLAQ    491 - 560
EEGVCGKFNLTNCCLELDDEGKVIKEITAKIQKLAHIPVQTWKG                              561 - 604
//

Text Mined References (33)

PMID Year Title
27486264 2016 The role of syncytins in human reproduction and reproductive organ cancers.
25016529 2014 Elevation of human ERV3-1 env protein expression in colorectal cancer.
24043713 2014 Human ERV3-1 env protein expression in various human tissues and tumours.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
19540319 2009 Classification and nomenclature of endogenous retroviral sequences (ERVs): problems and recommendations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15994821 2005 ERV3 and related sequences in humans: structure and RNA expression.
15081124 2004 Conservation and loss of the ERV3 open reading frame in primates.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12083821 2002 Developmental expression of HERV-R (ERV3) and HERV-K in human tissue.
10894926 2000 Assignment of the endogenous retrovirus HERV-R (ERV3) to human chromosome 7q11.2 by radiation hybrid mapping.
10692254 2000 The cellular mechanism by which the human endogenous retrovirus ERV-3 env gene affects proliferation and differentiation in a human placental trophoblast model, BeWo.
10427470 1998 Large number of polymorphic nucleotides and a termination codon in the env gene of the endogenous human retrovirus ERV3.
9525678 1998 Physiological knockout of the envelope gene of the single-copy ERV-3 human endogenous retrovirus in a fraction of the Caucasian population.
9458354 1998 Expression of human endogenous retrovirus ERV3 (HERV-R) mRNA in normal and neoplastic tissues.
9209324 1997 Human endogenous retroviruses: expression in various organs in vivo and its regulation in vitro.
9209323 1997 Tissue and differentiation specific expression on the endogenous retrovirus ERV3 (HERV-R) in normal human tissues and during induced monocytic differentiation in the U-937 cell line.
8592062 1996 Elevated levels of the endogenous retrovirus ERV3 in human sebaceous glands.
7716822 1994 Expression of an endogenous retrovirus (ERV3 HERV-R) in human reproductive and embryonic tissues--evidence for a function for envelope gene products.
7645262 1995 Abundance of an endogenous retroviral envelope protein in placental trophoblasts suggests a biological function.
6505687 1984 The long terminal repeat sequences of a novel human endogenous retrovirus.
6495650 1984 ERV3, a full-length human endogenous provirus: chromosomal localization and evolutionary relationships.
3840930 1985 The nucleotide sequence of the env gene from the human provirus ERV3 and isolation and characterization of an ERV3-specific cDNA.
3356751 1988 ERV3 human endogenous provirus mRNAs are expressed in normal and malignant tissues and cells, but not in choriocarcinoma tumor cells.
3346101 1988 Absence of expression of a human endogenous retrovirus is correlated with choriocarcinoma.
2884330 1987 Tissue-specific expression of human provirus ERV3 mRNA in human placenta: two of the three ERV3 mRNAs contain human cellular sequences.
2115127 1990 Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Krüppel.
1783368 1991 [Integration and expression of human endogenous retrovirus].