Property Summary

NCBI Gene PubMed Count 68
PubMed Score 77.31
PubTator Score 60.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

AA Sequence

MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHA      1 - 70
SKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLF     71 - 140
PCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYA    141 - 210
YFDTPAVSAADLSYVSDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDK    211 - 280
PEVPPRVPIPPRPVKPDYRRWSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQ    281 - 350
SFAPDPKYVSSKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG    351 - 420
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP                                421 - 462
//

Text Mined References (75)

PMID Year Title