Property Summary

NCBI Gene PubMed Count 28
PubMed Score 26.73
PubTator Score 29.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 9.6e-04
Multiple myeloma 1.292 2.1e-03
malignant mesothelioma 2.700 9.2e-09
psoriasis -2.300 2.3e-05
osteosarcoma -1.601 6.7e-05
astrocytoma 1.400 2.2e-03
glioblastoma 1.800 1.1e-04
atypical teratoid / rhabdoid tumor -1.600 2.4e-04
pancreatic ductal adenocarcinoma liver m... -1.306 2.4e-02
lung cancer -1.200 8.2e-03
adult high grade glioma -1.200 2.2e-03
subependymal giant cell astrocytoma 1.241 7.9e-03
ovarian cancer 2.600 9.8e-07

 GWAS Trait (1)

Gene RIF (15)

PMID Text
25512553 the decrease in 5-HT uptake rates of GDM trophoblast is the consequence of defective insulin signaling, which entraps SERT with ERp44 and impairs its glycosylation.
25097228 Endogenous ERp44 is O-glycosylated and secreted by human primary endometrial cells, suggesting possible pathophysiological roles of these processes.
24804790 findings indicated that overexpression of miR-101 could downregulate ERp44
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23685074 The ERp44 assembly control cycle couples secretion fidelity and efficiency downstream of the calnexin/calreticulin and BiP-dependent quality control cycles.
22451649 ERp44 together with Ero1-Lalpha plays an important role in disulfide formation of SERT, which may be a prerequisite step for the assembly of SERT molecules in oligomeric form.
22190034 HIV-1 gp120 is identified to have a physical interaction with endoplasmic reticulum protein 44 (ERP44) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18552768 Crystal structure of ERp44 at a resolution of 2.6 A, is presented.
18508857 Study shows that SUMF1 interacts with protein disulfide isomerase (PDI) and ERp44, two thioredoxin family members residing in the early secretory pathway, and with ERGIC-53, a lectin that shuttles between the ER and the Golgi.
18178549 ERp44-mediated retention of FGE, indicating that noncovalent interactions between ERp44 and FGE are sufficient to mediate ER retention.
17805346 ERGIC-53 provides a platform that receives micro(2)L(2) subunits from the BiP-dependent checkpoint, assisting polymerization. In this process, ERp44 couples thiol-dependent assembly and quality control.
16677073 Ero1alpha and Ero1beta are retained in the endoplasmic reticulum by interactions with PDI and ERp44
11847130 contains a thioredoxin domain with a CRFS motif and is induced during ER stress

AA Sequence

MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEE      1 - 70
ASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQK     71 - 140
SDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNII    141 - 210
YKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQ    211 - 280
NEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFD    281 - 350
LHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL                  351 - 406
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25512553 2014 GDM-associated insulin deficiency hinders the dissociation of SERT from ERp44 and down-regulates placental 5-HT uptake.
25097228 2014 Progressive quality control of secretory proteins in the early secretory compartment by ERp44.
24804790 2014 MiR-101 regulates apoptosis of trophoblast HTR-8/SVneo cells by targeting endoplasmic reticulum (ER) protein 44 during preeclampsia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979138 2013 Dynamic regulation of Ero1? and peroxiredoxin 4 localization in the secretory pathway.
23685074 2013 A pH-regulated quality control cycle for surveillance of secretory protein assembly.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22451649 2012 The role of ERp44 in maturation of serotonin transporter protein.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19995400 2010 Platelets release novel thiol isomerase enzymes which are recruited to the cell surface following activation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18552768 2008 Crystal structure of human ERp44 shows a dynamic functional modulation by its carboxy-terminal tail.
18508857 2008 Multistep, sequential control of the trafficking and function of the multiple sulfatase deficiency gene product, SUMF1 by PDI, ERGIC-53 and ERp44.
18178549 2008 ERp44 mediates a thiol-independent retention of formylglycine-generating enzyme in the endoplasmic reticulum.
17805346 2007 Sequential steps and checkpoints in the early exocytic compartment during secretory IgM biogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16677073 Dynamic retention of Ero1alpha and Ero1beta in the endoplasmic reticulum by interactions with PDI and ERp44.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15652484 2005 Subtype-specific and ER lumenal environment-dependent regulation of inositol 1,4,5-trisphosphate receptor type 1 by ERp44.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517240 2003 Thiol-mediated protein retention in the endoplasmic reticulum: the role of ERp44.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11921445 2002 Towards complete analysis of the platelet proteome.
11847130 2002 ERp44, a novel endoplasmic reticulum folding assistant of the thioredoxin family.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.