Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.49
PubTator Score 7.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -3.167 1.4e-07
atypical teratoid / rhabdoid tumor -1.600 1.1e-05
glioblastoma -1.700 1.8e-04
medulloblastoma -1.300 4.2e-03
medulloblastoma, large-cell -1.500 1.1e-03
primary pancreatic ductal adenocarcinoma -2.839 3.0e-04
intraductal papillary-mucinous adenoma (... -2.900 8.5e-04
intraductal papillary-mucinous carcinoma... -4.000 2.2e-05
intraductal papillary-mucinous neoplasm ... -5.200 3.3e-05
active Crohn's disease 1.428 7.0e-03
pancreatic cancer -2.700 8.1e-04
adult high grade glioma -1.600 1.6e-04
nasopharyngeal carcinoma 1.300 1.2e-02
lung carcinoma 2.100 1.8e-27
Pick disease -1.100 2.9e-06
Breast cancer -1.300 4.7e-03
gastric carcinoma -2.600 1.1e-02
invasive ductal carcinoma 1.100 3.5e-03
ovarian cancer -1.800 1.2e-10

Gene RIF (10)

PMID Text
26765469 upregulated in pancreatic neuroendocrine tumors
21091435 In the present work, it was shown that recombinant human Ero1beta is twice as active as Ero1alpha in enzymatic assays.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
18996753 The lack of correlation between changes in SAT adiponectin gene and protein expression and its circulating levels suggests that adipose tissue synthesis and release of adiponectin are highly regulated pathways.
18395550 Observational study of gene-disease association. (HuGE Navigator)
16822866 the Ero FAD binding domain is critical for conformational stability, allowing Ero proteins to withstand stress conditions that cause client proteins to misfold
16677073 Ero1alpha and Ero1beta are retained in the endoplasmic reticulum by interactions with PDI and ERp44
16012172 analysis of Ero1beta tissue distribution and dimerization
15161913 glutathione limits Ero1-dependent oxidation in the endoplasmic reticulum

AA Sequence

MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPKIKKLQERDYF      1 - 70
RYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAIN     71 - 140
STLSNQSKEAFIDWARYDDSRDHFCELDDERSPAAQYVDLLLNPERYTGYKGTSAWRVWNSIYEENCFKP    141 - 210
RSVYRPLNPLAPSRGEDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNI    211 - 280
KEFKHRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDT    281 - 350
KSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI    351 - 420
QKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRDLQNFKVLLQHSR                           421 - 467
//

Text Mined References (21)

PMID Year Title
26765469 2016 The Immunohistochemical Evaluation of Solid Pseudopapillary Tumors of the Pancreas and Pancreatic Neuroendocrine Tumors Reveals ERO1L? as a New Biomarker.
21091435 2011 The endoplasmic reticulum sulfhydryl oxidase Ero1? drives efficient oxidative protein folding with loose regulation.
20802462 2010 Disulphide production by Ero1?-PDI relay is rapid and effectively regulated.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
18996753 Response of adiponectin and its receptors to changes in metabolic state after gastric bypass surgery: dissociation between adipose tissue expression and circulating levels.
18395550 2008 A polymorphism controlling ORMDL3 expression is associated with asthma that is poorly controlled by current medications.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16822866 2006 Mutations in the FAD binding domain cause stress-induced misoxidation of the endoplasmic reticulum oxidoreductase Ero1beta.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16677073 Dynamic retention of Ero1alpha and Ero1beta in the endoplasmic reticulum by interactions with PDI and ERp44.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16012172 2005 Tissue-specific expression and dimerization of the endoplasmic reticulum oxidoreductase Ero1beta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15161913 2004 Glutathione limits Ero1-dependent oxidation in the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12752442 2003 The cellular oxygen tension regulates expression of the endoplasmic oxidoreductase ERO1-Lalpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11847130 2002 ERp44, a novel endoplasmic reticulum folding assistant of the thioredoxin family.
11707400 2001 Manipulation of oxidative protein folding and PDI redox state in mammalian cells.
10818100 2000 Endoplasmic reticulum oxidoreductin 1-lbeta (ERO1-Lbeta), a human gene induced in the course of the unfolded protein response.