Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.08
PubTator Score 7.57

Knowledge Summary

Patent (1,890)

Expression

Gene RIF (8)

PMID Text
23236464 The luminal event mediated by IRE1beta involves direct interaction with unfolded proteins rather than association/dissociation with BiP.
21146530 Data show that IRE1beta represses translation on the ER membrane but not in the cytosol, and that this selective repression depends on the RNase activity of IRE1beta.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of endoplasmic reticulum to nucleus signaling 2 (ERN2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18242182 RNase domain of IRE1 determines the functional specificities of each of these isoforms.
16973740 The structural, biochemical, and functional studies in vivo altogether demonstrate that IRE1 and PERK have conserved a common molecular interface necessary and sufficient for dimerization and unfolded protein response (UPR) signaling.

AA Sequence

MASAVRGSRPWPRLGLQLQFAALLLGTLSPQVHTLRPENLLLVSTLDGSLHALSKQTGDLKWTLRDDPVI      1 - 70
EGPMYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSSDGVFYTGRKQDAWFVVDPES     71 - 140
GETQMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPALRWNTTYRRYSAPPMDGSPGKYMSHLASCGMGLLL    141 - 210
TVDPGSGTVLWTQDLGVPVMGVYTWHQDGLRQLPHLTLARDTLHFLALRWGHIRLPASGPRDTATLFSTL    211 - 280
DTQLLMTLYVGKDETGFYVSKALVHTGVALVPRGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGS    281 - 350
VALPSQWLLIGHHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEK    351 - 420
TPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRS    421 - 490
QKRLQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLRECFGLVRR    491 - 560
EVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQEYVENPDLDRGGLEPEVVLQQLMSGLAHLHS    561 - 630
LHIVHRDLKPGNILITGPDSQGLGRVVLSDFGLCKKLPAGRCSFSLHSGIPGTEGWMAPELLQLLPPDSP    631 - 700
TSAVDIFSAGCVFYYVLSGGSHPFGDSLYRQANILTGAPCLAHLEEEVHDKVVARDLVGAMLSPLPQPRP    701 - 770
SAPQVLAHPFFWSRAKQLQFFQDVSDWLEKESEQEPLVRALEAGGCAVVRDNWHEHISMPLQTDLRKFRS    771 - 840
YKGTSVRDLLRAVRNKKHHYRELPVEVRQALGQVPDGFVQYFTNRFPRLLLHTHRAMRSCASESLFLPYY    841 - 910
PPDSEARRPCPGATGR                                                          911 - 926
//

Text Mined References (15)

PMID Year Title
23236464 2012 Direct association of unfolded proteins with mammalian ER stress sensor, IRE1?.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21146530 2011 Mammalian ER stress sensor IRE1? specifically down-regulates the synthesis of secretory pathway proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18242182 2008 RNase domains determine the functional difference between IRE1alpha and IRE1beta.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16973740 2006 The crystal structure of human IRE1 luminal domain reveals a conserved dimerization interface required for activation of the unfolded protein response.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11175748 2001 Translational control by the ER transmembrane kinase/ribonuclease IRE1 under ER stress.
10619423 1999 A role for presenilin-1 in nuclear accumulation of Ire1 fragments and induction of the mammalian unfolded protein response.
9755171 1998 Cloning of mammalian Ire1 reveals diversity in the ER stress responses.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.