Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.33
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.206 5.2e-03
adult high grade glioma -1.300 5.8e-03
atypical teratoid / rhabdoid tumor -1.100 1.9e-02
breast carcinoma 1.300 3.5e-20
cystic fibrosis 1.064 1.4e-03
ductal carcinoma in situ 1.500 1.2e-04
glioblastoma -1.200 1.5e-03
group 4 medulloblastoma -2.000 4.0e-05
interstitial cystitis -1.400 2.6e-03
intraductal papillary-mucinous adenoma (... 1.600 8.0e-04
intraductal papillary-mucinous carcinoma... 1.400 7.7e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.9e-02
invasive ductal carcinoma 1.500 2.7e-03
lung cancer 1.100 2.1e-03
medulloblastoma, large-cell -2.200 8.0e-05
osteosarcoma -1.438 6.7e-04
ovarian cancer -1.900 4.6e-05
primitive neuroectodermal tumor -1.100 1.5e-04

Gene RIF (1)

AA Sequence

MEWGSESAAVRRHRVGVERREGAAAAPPPEREARAQEPLVDGCSGGGRTRKRSPGGSGGASRGAGTGLSE      1 - 70
VRAALGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYL     71 - 140
LEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLANCHFDSVA    141 - 210
NSPGASDDAVSCSVMLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAA    211 - 280
GVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENG    281 - 350
YIYHTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNMVFFDVLGLFVIAYPSRIGSII    351 - 420
NYMVVMGVVLYLGKKFLQPKHKTGNYKKDFLCGLGITLISWFTSLVTVLIIAVFISLIGQSLSWYNHFYV    421 - 490
SVCLYGTATVAKIILIHTLAKRFYYMNASAQYLGEVFFDISLFVHCCFLVTLTYQGLCSAFISAVWVAFP    491 - 560
LLTKLCVHKDFKQHGAQGKFIAFYLLGMFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGC    561 - 630
TMILSSYFINFIYLAKSTKKTMLTLTLVCAITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEG    631 - 700
NAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPR    701 - 770
NPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQA    771 - 840
SAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF          841 - 904
//

Text Mined References (11)

PMID Year Title