Property Summary

NCBI Gene PubMed Count 20
PubMed Score 490.83
PubTator Score 29.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.600 9.8e-03
medulloblastoma, large-cell -1.300 4.9e-04
ovarian cancer -1.500 8.8e-06
pancreatic cancer 1.100 2.5e-02
pancreatic carcinoma 1.100 2.5e-02
Pick disease -1.300 1.1e-03

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT      1 - 70
TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET     71 - 140
GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST    141 - 210
VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ    211 - 280
EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG    281 - 350
WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI    351 - 420
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN           421 - 483
//

Text Mined References (21)

PMID Year Title