Property Summary

NCBI Gene PubMed Count 20
PubMed Score 457.74
PubTator Score 29.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 2.5e-02
medulloblastoma, large-cell -1.300 4.9e-04
intraductal papillary-mucinous neoplasm ... -1.600 9.8e-03
pancreatic carcinoma 1.100 2.5e-02
Pick disease -1.400 5.8e-06
ovarian cancer -1.500 8.8e-06

Synonym

Accession Q96DZ1 B2RDB4 B5MC72 O95901 Q6UWN7 Q9NUY7 Q9UQL4
Symbols CIM
HEL117
XTP3-B
C2orf30
CL24936
CL25084
XTP3TPB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (5)

Gene RIF (9)

PMID Text
23356641 Lectin activity of XTP3-B is required for its interaction with the misfolded glycoprotein alpha1-antitrypsin variant.
23097496 Data indicate that the interaction of OS-9 and XTP3-B with CD147(CG) was inhibited by mutations to conserved residues in their lectin domains.
22190034 HIV-1 gp41 is identified to have a physical interaction with endoplasmic reticulum lectin 1 (ERLEC1; XTP3B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21404621 It regulates endoplasmic reticulum-associated degradation. (review)
21118962 Findings shed light on how tolerance to multiple cellular stresses at a metastatic site can be evoked by an integrated mechanism involving CIM, ERLEC1, which can function to coordinate those responses in a manner that promotes metastatic cell survival.
21062743 mannose trimming enables delivery of a substrate glycoprotein from EDEM1 to late endoplsmic reticulum degredation steps through association with XTP3-B
19917667 XTP3-B specifically binds to AT(NHK), which is a well-known substrate of ERAD, via a C-terminal MRH domain in a glycan-dependent manner.
18502753 XTP3-B forms an endoplasmic reticulum quality control scaffold with the HRD1-SEL1L ubiquitin ligase complex and BiP
16531414 Erlectin functions in N-glycan recognition in the endoplasmic reticulum and may regulate glycoprotein traffic

AA Sequence

MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT      1 - 70
TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET     71 - 140
GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST    141 - 210
VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ    211 - 280
EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG    281 - 350
WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI    351 - 420
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN           421 - 483
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
23356641 2013 Endoplasmic reticulum lectin XTP3-B inhibits endoplasmic reticulum-associated degradation of a misfolded ?1-antitrypsin variant.
23097496 2012 Unassembled CD147 is an endogenous endoplasmic reticulum-associated degradation substrate.
21723917 2011 Mannose 6-phosphate receptor homology (MRH) domain-containing lectins in the secretory pathway.
21404621 2011 [OS-9 and XTP3-B: lectins that regulate endoplasmic reticulum-associated degradation (ERAD)].
21118962 2010 Novel metastasis-related gene CIM functions in the regulation of multiple cellular stress-response pathways.
21062743 2011 Mannose trimming is required for delivery of a glycoprotein from EDEM1 to XTP3-B and to late endoplasmic reticulum-associated degradation steps.
20816211 2010 Mannose 6-phosphate receptor homology domain-containing lectins in mammalian endoplasmic reticulum-associated degradation.
19917667 2010 Human XTP3-B binds to alpha1-antitrypsin variant null(Hong Kong) via the C-terminal MRH domain in a glycan-dependent manner.
18538572 2008 Sweet bays of ERAD.
18502753 2008 Human XTP3-B forms an endoplasmic reticulum quality control scaffold with the HRD1-SEL1L ubiquitin ligase complex and BiP.
18264092 2008 OS-9 and GRP94 deliver mutant alpha1-antitrypsin to the Hrd1-SEL1L ubiquitin ligase complex for ERAD.
16531414 2006 The MRH protein Erlectin is a member of the endoplasmic reticulum synexpression group and functions in N-glycan recognition.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.