Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0

Expression

AA Sequence

MELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDSLLWIREELGNLRRVDVQLLG      1 - 70
QLCSLGLEMGALREELVTILEEEEESSKEEEEDQEPQRKQEEEHLEACPAPHPPDFEMMI               71 - 130
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.