Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.34
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Rheumatoid arthritis 1191 9.4e-03
Disease Target Count Z-score Confidence
Dengue shock syndrome 6 3.641 1.8
Dengue hemorrhagic fever 4 3.334 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid arthritis -1.600 9.4e-03

Gene RIF (3)

AA Sequence

MATASPAADGGRGRPWEGGLVSWPPAPPLTLPWTWMGPSWGQHPGHWGFPALTEPSASPAAGLGIFEVRR      1 - 70
VLDASGCSMLAPLQTGAARFSSYLLSRARKVLGSHLFSPCGVPEFCSISTRKLAAHGFGASMAAMVSFPP     71 - 140
QRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAM    141 - 210
VDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYS    211 - 280
FAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF                 281 - 337
//

Text Mined References (14)

PMID Year Title