Property Summary

NCBI Gene PubMed Count 23
PubMed Score 171.46
PubTator Score 15.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.102 4.8e-03
Multiple myeloma 1.181 3.3e-03
osteosarcoma 1.651 1.6e-05
primary pancreatic ductal adenocarcinoma 1.035 4.1e-03
diabetes mellitus -1.600 1.4e-03
mucosa-associated lymphoid tissue lympho... -1.185 9.4e-03

Gene RIF (11)

PMID Text
26100022 ERH regulation of RNA processing is needed to ensure faithful DNA replication and repair.
24078386 REVIEW: recent findings indicate that ERH plays an important role in cell cycle through its mRNA splicing activity and is critically required for genomic stability and cancer cell survival
24015320 Identification of amino acid residues of ERH required for its recruitment to nuclear speckles and replication foci
23236152 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
22704934 ERH contributes to chromosome alignment at the metaphase plate by localizing CENP-E at kinetochore regions.
22174317 HIV-1 Rev interacting protein, enhancer of rudimentary homolog (ERH), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with ERH is increased by RRE
19460752 Knockdown of enhancer of rudimentary homolog (Drosophila, ERH) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18500978 Enhancer of rudimentary homolog (ERH) overexpression may be implicated in the initiation and/or progression of certain human malignancies.
18081865 interaction with ERH could block the binding of p21(Cip1/Waf1) by Ciz1 in the cell. When ERH and Ciz1 are coexpressed in HeLa cells, Ciz1 recruits ERH to DNA replication foci
17444515 ERH may be an important transcription regulator that also functions in the control of cell-cycle progression.
15794639 molecular structure, dimerization and protein-protein interactions

AA Sequence

MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL      1 - 70
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK                                         71 - 104
//

Text Mined References (31)

PMID Year Title
26100022 2015 Enhancer of Rudimentary Homolog Affects the Replication Stress Response through Regulation of RNA Processing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
24078386 2013 The enigmatic ERH protein: its role in cell cycle, RNA splicing and cancer.
24015320 2013 Identification of amino acid residues of ERH required for its recruitment to nuclear speckles and replication foci in HeLa cells.
23236152 2012 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22704934 2012 Enhancer of rudimentary homolog (ERH) plays an essential role in the progression of mitosis by promoting mitotic chromosome alignment.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18500978 2008 Enhancer of the rudimentary gene homologue (ERH) expression pattern in sporadic human breast cancer and normal breast tissue.
18081865 2008 Ciz1, a p21 cip1/Waf1-interacting zinc finger protein and DNA replication factor, is a novel molecular partner for human enhancer of rudimentary homolog.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17444515 2007 A 1.55 A resolution X-ray crystal structure of HEF2/ERH and insights into its transcriptional and cell-cycle interaction networks.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16984396 2006 Human enhancer of rudimentary is a molecular partner of PDIP46/SKAR, a protein interacting with DNA polymerase delta and S6K1 and regulating cell growth.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15794639 2005 Structure of the conserved transcriptional repressor enhancer of rudimentary homolog.
15670829 2005 Identification of proteins interacting with the RNAPII FCP1 phosphatase: FCP1 forms a complex with arginine methyltransferase PRMT5 and it is a substrate for PRMT5-mediated methylation.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15166316 2004 Dissection of the mammalian midbody proteome reveals conserved cytokinesis mechanisms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9074495 1997 The putative cell cycle gene, enhancer of rudimentary, encodes a highly conserved protein found in plants and animals.
8786099 1996 Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene.