Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.08
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.200 6.5e-03
osteosarcoma 1.588 2.8e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
group 4 medulloblastoma -1.600 4.3e-03
medulloblastoma, large-cell -2.200 2.9e-06
hereditary spastic paraplegia -1.020 2.1e-02
juvenile dermatomyositis 1.063 2.6e-11
tuberculosis and treatment for 6 months -1.800 4.0e-05
Breast cancer 2.100 3.9e-02
adult high grade glioma -1.300 3.7e-03
pancreatic carcinoma 1.200 6.5e-03
lung adenocarcinoma 1.097 4.7e-05
ovarian cancer 3.300 2.1e-07
dermatomyositis 1.100 5.4e-03

Gene RIF (6)

PMID Text
24303950 A variant of ERGIC2 with four coding bases deleted has an abrogated function as a transport shuttle, but does continue to upregulate the heme oxygenase 1 gene, suggesting that it may be involved in the oxidative stress pathway.
22190034 HIV-1 gp160 is identified to have a physical interaction with ERGIC and golgi 2 (ERGIC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17980171 CDA14 participated in the elongation factor 1alpha regulated mechanisms
16989575 Ectopic expression of a partial sequence of PTX1 (Met84 - Leu225) as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence.
15308636 ERGIC-32 functions as a modulator of the hErv41-hErv46 complex by stabilizing hErv46
12932305 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWMKYEYEVDKDF      1 - 70
SSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSL     71 - 140
QDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAALVNHES    141 - 210
YNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIIN    211 - 280
HAAGSHGVSGIFMKYDLSSLMVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLG    281 - 350
SYKPVNSVPFEDGHTDNHLPLLENNTH                                               351 - 377
//

Text Mined References (14)

PMID Year Title
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24303950 2014 Characterization of a variant of ERGIC2 transcript.
19946888 2010 Defining the membrane proteome of NK cells.
17980171 2008 The possible interaction of CDA14 and protein elongation factor 1alpha.
16989575 2006 PTX1(ERGIC2)-VP22 fusion protein upregulates interferon-beta in prostate cancer cell line PC-3.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12932305 2003 Effects of PTX1 expression on growth and tumorigenicity of the prostate cancer cell line PC-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11445006 2001 Molecular cloning, expression, localization, and gene organization of PTX1, a human nuclear protein that is downregulated in prostate cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.