Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.89
PubTator Score 1.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.3e-02
interstitial lung disease -2.100 5.2e-03
osteosarcoma -1.645 6.3e-04
glioblastoma 1.100 1.6e-03
juvenile dermatomyositis 1.216 7.3e-10
pancreatic ductal adenocarcinoma liver m... -1.625 3.0e-03
pilocytic astrocytoma 1.400 1.3e-05
Pneumonia 1.200 3.7e-02
invasive ductal carcinoma 1.300 1.4e-03
ovarian cancer 1.800 3.6e-05

Gene RIF (7)

PMID Text
22761906 AIM1, ERGIC1, and TPX2 were shown to be highly expressed especially in prostate cancer tissues, and high mRNA expression of ERGIC1 and TMED3 associated with AR and ERG oncogene expression
22190034 HIV-1 Nef is identified to have a physical interaction with endoplasmic reticulum-golgi intermediate compartment 1 (ERGIC1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
15308636 ERGIC-32 functions as a modulator of the hErv41-hErv46 complex by stabilizing hErv46

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKID      1 - 70
VSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQ     71 - 140
PQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYT    141 - 210
VANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEA    211 - 280
WKKIQLGKMH                                                                281 - 290
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22761906 2012 High-throughput transcriptomic and RNAi analysis identifies AIM1, ERGIC1, TMED3 and TPX2 as potential drug targets in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.