Property Summary

NCBI Gene PubMed Count 209
PubMed Score 296.82
PubTator Score 283.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

 GO Component (2)

Gene RIF (176)

PMID Text
26833090 Results show that XPG partners with BRCA1 and BRCA2 to maintain genomic stability through homologous recombination, and its loss causes DNA breaks, chromosome aberrations, and replication fork stalling.
26411687 Helicobacter Pylori introduces double-stranded DNA breaks by the nucleotide excision repair endonucleases XPF and XPG, which, together with RelA, are recruited to chromatin in a highly coordinated, type IV secretion system-dependent manner.
26338418 Individuals that harbor uORF1 of ERCC5 have a marked resistance to platinum-based agents
26225711 ERCC5 rs17655 polymorphism might contribute to genetic susceptibility to colorectal cancer.
26149386 The results suggest that the XPG-TFIIH complex is involved in transcription elongation and that defects in this association may partly account for Cockayne syndrome in xeroderma pigmentosum group G/Cockayne Syndrome patients.
26045839 our study indicated that ERCC5 rs2094258 polymorphism may contribute to the risk of breast cancer.
25987016 XPG Asp1104His polymorphism is a risk factor for head and neck cancer susceptibility.
25835182 It has been found that the genotype 751Gln/Gln and allele Gln of ERCC2 gene and allele Asp of 312Asn/Asp polymorphism of ERCC2 gene may be associated with an increased risk of colorectal cancer.
25729984 the rs2296147 and rs2094258 polymorphisms of XPG, could be used as surrogate markers, leading to individualization of non-small cell lung cancer treatment strategies.
25483071 CDT2 mediated XPG elimination from DNA damage sites clears the chromatin space needed for repair.
25332048 conclusion, our findings suggest that XPG Asp1104His polymorphism may increase the susceptibility of CRC, especially in Asian populations.
25311495 Data show increased risk of leukemia with XPCC protein (XPC) 939Gln/Gln genotype, ERCC2 protein (XPD) 751Gln allele may be protective against chronic myeloid leukemia and acute myeloid leukemia, and no significant risk for the ERCC5 protein (XPG) gene.
25231183 This meta-analysis suggested that the XPG Asp1104His polymorphism was a risk factor for melanoma susceptibility.
25023406 the ERCC2 Lys751Gln and ERCC5 His46His polymorphisms might influence osteosarcoma prognosis.
24990617 The XPC rs2228000 TT genotype is associated with shorter overall survival in gastric cancer.
24802942 Meta-analysis suggests that XPF Arg415Gln polymorphism may be associated with decreased lung cancer risk and XPG Asp1104His may be a low-penetrant risk factor in some cancers development.
24782167 our study indicated that XRCC1 Arg399Gln and ERCC5 His46His might significantly influence the response to chemotherapy
24737519 XRCC1 Arg399Gln and XPG His46His might significantly affect the clinical outcomes of platinum-based chemotherapy.
24700531 Our data broaden the reported clinical spectrum of ERCC5 mutations and provide further evidence of genotype-phenotype correlation with truncating mutations being associated with severe phenotypes.
24615519 study provided statistical evidence that XPG rs2296147T>C and rs873601G>A polymorphisms may be used as surrogate markers toward individualizing non-small cell lung cancer treatment strategies
24615090 Results found that polymorphisms in XPG rs2296147 and CSB rs2228526 were significantly associated with prostate cancer susceptibility in the Chinese population analyzed.
24596032 ERCC5 rs17655 polymorphism may not contribute to genetic susceptibility for lung cancer
24563277 genetic variations in ERCC1 rs11615 and ERCC5 rs17655 are associated with laryngeal cancer risk in a Chinese population, especially in ever smokers and drinkers.
24354460 A novel mutation in ERCC5, causative of a pellagra-like condition linked to xeroderma pigmentosum/Cockayne syndrome complex.
24192772 Homozygoty for the wild-type Asp1104 SNP of the ERCC5 gene was found in 2 cases of relapsed osteosarcoma, who responded to trabectedin.
24061640 XPG Asp1104His polymorphism was not associated with bladder cancer risk.
23886164 XPG polymorphisms are associated with response to chemotherapy in osteosarcoma.
23818366 ERCC5 SNPs do not appear to play a major role in lymphoma susceptibility in a Spanish population.
23679317 Single nucleotide polymorphisms in the ERCC5 gene is associated with bone malignant tumors.
23626689 Associations of the MTHFR Glu429Ala and ERCC5 His46His polymorphisms with survival were identified in two colorectal cancer patient cohorts.
23621222 polymorphisms in rs1047768 C/T and rs2296147 C/T are associated with response to platinum-based chemotherapy in advanced non-small-cell lung cancer, and XPG polymorphisms could be predictive of prognosis.
23534771 The ERCC5 Asp1558His G/G genotype was associated with elevated susceptibility to gliomas and meningiomas.
23464443 Three SNPs of XPG, rs2296147T>C, rs2094258C>T and rs873601G>A, were genotyped.
23424205 The results demonstrated that 50 microg/mL beta-glucan significantly repressed the expression of the ERCC5 gene, no change in CASP9 expression, and induction of the CYP1A1 gene.
23370536 Three XPG missense mutations in the I-region of XPG impair repair and transcription and result in severe xeroderma pigmentosum/Cockayne syndrome.
23330005 The highest staining was detected in adrenal gland, breast, colon, heart, kidney, thyroid and tongue; in tumors, positive staining was observed in 9 of 10 breast cancer samples and in all 5 ovarian cancer and 5 sarcomas samples.
23255472 This work adds novel allelic pathological variants to the panel of known XPG gene mutants and indicates that the mutated XPG proteins are unable to protect the cells from some genotoxic stresses.
23246108 The XPG gene polymorphism was also related to bladder cancer yet it was prevalent in female non-smokers.
22982416 investigated effects of two putatively functional polymorphisms in ERCC5 promoter region, rs751402 (+25A>G) and rs2296147 (+202C>T), and their potential interaction with environment factors on the risk of developing gastric cancer
22981091 ERCC rs751402 CC genotype is significantly associated with decreased risk of OSCC, whereas the T allotype is correlated with higher risk of OSCC
22848513 These findings suggested that ERCC5 polymorphisms may contribute to risk of ESCC in Eastern Chinese populations
22815677 it is unlikely that the ERCC5 Asp1104His polymorphism may contribute to individual susceptibility to cancer risk
22781116 Down-regulating XPG in epithelial ovarian cancer cells resulted in reduced cell growth and increased susceptibility to cisplatin.
22771116 XPG endonuclease promotes DNA breaks and DNA demethylation at promoters allowing the recruitment of CTCF and gene looping, which is further stabilized by XPF.
22659345 Single nucleotide polymorphisms (SNPs) of OGG1, XRCC1, ERCC5, and XRCC4 were significantly associated with the overall survival in patients with hepatitis B virus-associated hepatocellular carcinoma.
22371296 study provided statistical evidence that the XPG rs873601 SNP, which has an effect on the gene expression in a recessive manner, was associated with risk for gastric cancer among an Eastern Chinese population.
22213216 XPG Asp1104His polymorphism might contribute to the identification of patients with increased risk for colorectal carcinoma
22108238 These findings suggest that genetic variation in ERCC5 may not affect the risk of SCCHN, although rs4150351 C variant genotypes were associated with an increased expression of ERCC5 mRNA and nonsignificantly decreased risk of SCCHN
21670956 Statistically significant increased risk of prostate cancer was observed on individuals that possess the His/His genotype of Asp 1104His of XPG.
21558802 novel function for XPG in S phase that is, at least in part, performed coordinately with WRN, and which may contribute to the severity of the phenotypes that occur upon loss of XPG.
21426550 The XPC, ERCC2 and ERCC5 variants don't affect the tumors stage and grade.
21424776 This meta-analysis suggests that XPG Asp1104His polymorphism is not associated with increased breast cancer risk.
21390047 ERCC5 codon 1104 and ERCC2 codon 751 polymorphisms are independent prognostic factors in patients with cutaneous melanoma.
20868484 XPG gene expression can be influenced by an epigenetic mechanism. Restoration of NER activity through XPG gene transfer or treatment with demethylating agents restored sensitivity to nemorubicin.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20530453 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20460046 XPC and XPG polymorphisms do not independently affect the susceptibility to hepatocellular carcinoma, but the joint effect of C allele of XPC Lys939Gln and female sex may modify the risk.
20460046 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20391347 Observational study of gene-disease association. (HuGE Navigator)
20233728 rs751402 A allele and rs2296147 T allele are associated with higher Allele-specific expression of ERCC5 T allele transcript at rs1047768 in normal human bronchial epithelial cells.
20232390 Observational study of gene-disease association. (HuGE Navigator)
20199546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20183911 Polymorphisms in the ERCC5 gene is associated with with breast cancer and this association was more pronounced in women with lengthy estrogen exposure.
20183911 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20150366 Observational study of gene-disease association. (HuGE Navigator)
19954624 Observational study of gene-disease association. (HuGE Navigator)
19878615 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19740755 BRG1 stimulates the recruitment of XPG and PCNA to successfully culminate the nucleotide excision repair.
19693700 There was significant difference in the frequency of the His/His variant genotype between cases and controls indicating a probable role of XPG in host viral interactions.
19693700 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19661089 PTGS2 and ERCC5 were associated with stomach cancer risk in a Chinese population.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19444904 Genetic polymorphisms in ERCC5 is associated with Laryngeal cancer risk associated with smoking and alcohol consumption.
19434073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19430706 Results showed that polymorphism in XPG His46His was associated with a decreased treatment response, but was not statistically significant.
19430706 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19414392 Observational study of gene-disease association. (HuGE Navigator)
19404856 the ERCC5 mutation may contribute to development of gastric and colorectal carcinomas with MSI
19350405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19289372 the combination of high BRCA1 and low XPG expression increases the risk of shorter survival in early non-small-cell lung cancer
19280628 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19270000 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19157633 the polymorphic status of XPG His46His was associated with susceptibility of chemotherapy in advanced non-small cell lung carcinoma
19157633 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19124519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19096231 These findings offer evidence of the association between polymorphisms [ XPG Asp1104Asp (GG) and XPD Asn312Asn (AA)] and decreased risk for cervical carcinoma or cervical squamous cell carcinoma.
19096231 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19029193 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990748 Meta-analysis of gene-disease association. (HuGE Navigator)
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18830263 Observational study of gene-disease association. (HuGE Navigator)
18825991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18767034 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18709642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18701435 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18478970 Observational study of genotype prevalence. (HuGE Navigator)
18320070 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18204222 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18204222 patients treated with first-line oxaliplatin/fluoropyrimidine harboring both XPG C/C and XPA A/G or A/A profiles have a longer survival and TTP.
18079701 During nucleotide excision repair of DNA, the recruitment of Pol delta is associated with release of XPG and replication protein A (RPA).
18077223 molecular basis of disease caused by TFIIH and XPG mutations [review]
18026184 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17932351 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17893230 CEBPG regulates ERCC5 expression and this regulation is modified by E2F1/YY1 interactions.
17855454 Observational study of gene-disease association. (HuGE Navigator)
17855454 SNPs associated with prognosis of lung cancer was mapped to ERCC5.
17825393 Observational study of gene-disease association. (HuGE Navigator)
17712032 Observational study of gene-disease association. (HuGE Navigator)
17685459 Observational study of gene-disease association. (HuGE Navigator)
17575242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17494052 Observational study of gene-disease association. (HuGE Navigator)
17476281 Observational study of gene-disease association. (HuGE Navigator)
17466625 XPG forms a stable complex with TFIIH, which is active in transcription and nucleotide excision repair
17438655 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17374967 Observational study of gene-disease association. (HuGE Navigator)
17313739 Observational study of gene-disease association. (HuGE Navigator)
17299578 Meta-analysis of gene-disease association. (HuGE Navigator)
17164380 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17121236 Observational study of gene-disease association. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
16985021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16979838 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16823510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16738949 Observational study of gene-disease association. (HuGE Navigator)
16646069 Observational study of genotype prevalence. (HuGE Navigator)
16646069 potential implication of the XPG Asp1104His polymorphism in the occurrence of chromosomal translocations associated with specific subtypes of sarcomas
16609022 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16536785 Observational study of gene-disease association. (HuGE Navigator)
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16399771 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16343742 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16284373 Observational study of gene-disease association. (HuGE Navigator)
16284370 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16258177 Observational study of gene-disease association. (HuGE Navigator)
16246722 The XPG binds transcription-sized DNA bubbles through two domains not required for incision and functionally interacts with Cockayne Syndrome Group B on these bubbles to stimulate its ATPase activity.
16195237 Observational study of gene-disease association. (HuGE Navigator)
16167068 XPG suppresses UV-induced apoptosis via its endonuclease function.
16094634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15992842 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15849729 Observational study of gene-disease association. (HuGE Navigator)
15746040 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15590680 the N-terminal portion of the spacer region is particularly important for nucleotide excision repair progression by mediating the XPG-TFIIH interaction and XPG substrate specificity
15572672 A short region of XPGC has been defined as necessary for TFIIH interaction and stable recruitment to sites of UV damage.
15494739 Observational study of gene-disease association. (HuGE Navigator)
15328203 XPG expression in solid tumors may be a useful marker to predict their sensitivity to irofulven.
15082767 Results suggest that the Cockayne syndrome phenotype results from C-terminal truncations in the XPG (xeroderma pigmentosum) gene in mice and humans.
14729591 Observational study of gene-disease association. (HuGE Navigator)
14688016 Observational study of gene-disease association. (HuGE Navigator)
12869423 Observational study of gene-disease association. (HuGE Navigator)
12865926 Observational study of gene-disease association. (HuGE Navigator)
12644470 results show that XPG endonuclease has distinct requirements for binding and cleaving DNA substrates
12494477 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRI      1 - 70
RPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRE     71 - 140
NDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILTDMKE    141 - 210
FTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRR    211 - 280
VVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQA    281 - 350
ALLGSSSEEELESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR    351 - 420
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVHVGTEAFPISD    421 - 490
ESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHAEVLEQQNELCPYESKFDSSL    491 - 560
LSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNVENVVSFNAKEHENFLETIQEQQTTESAGQD    561 - 630
LISIPKAVEPMEIDSEESESDGSFIEVQSVISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESL    631 - 700
LRDNSERDDVDGEPQEAEKDAEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFL    701 - 770
ESQELLRLFGIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF    771 - 840
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQKNPKIRPNPH    841 - 910
DTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPV    911 - 980
LKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDK    981 - 1050
AKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAK   1051 - 1120
EPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT       1121 - 1186
//

Text Mined References (213)

PMID Year Title
26833090 2016 Non-catalytic Roles for XPG with BRCA1 and BRCA2 in Homologous Recombination and Genome Stability.
26411687 2015 H. pylori-Induced DNA Strand Breaks Are Introduced by Nucleotide Excision Repair Endonucleases and Promote NF-?B Target Gene Expression.
26338418 2015 A common polymorphism in the 5' UTR of ERCC5 creates an upstream ORF that confers resistance to platinum-based chemotherapy.
26225711 2015 Genetic Association between ERCC5 rs17655 Polymorphism and Colorectal Cancer Risk: Evidence Based on a Meta-analysis.
26149386 2015 Regulation of Transcription Elongation by the XPG-TFIIH Complex Is Implicated in Cockayne Syndrome.
26045839 2015 Association between ERCC5 gene polymorphisms and breast cancer risk.
25987016 2015 Genetic Association between the XPG Asp1104His Polymorphism and Head and Neck Cancer Susceptibility: Evidence Based on a Meta-Analysis.
25835182 2015 An association of selected ERCC2 and ERCC5 genes polymorphisms, the level of oxidative DNA damage and its repair efficiency with a risk of colorectal cancer in Polish population.
25729984 2015 XPG polymorphisms are associated with prognosis of advanced non-small cell lung cancer treated with platinum-based doublet chemotherapy.
25483071 2015 Cdt2-mediated XPG degradation promotes gap-filling DNA synthesis in nucleotide excision repair.
25332048 2014 Association study between XPG Asp1104His polymorphism and colorectal cancer risk in a Chinese population.
25311495 2015 Polymorphisms in XPC, XPD and XPG DNA repair genes and leukemia risk in a Tunisian population.
25231183 2015 Current evidences on the XPG Asp1104His polymorphism and melanoma susceptibility: a meta-analysis based on case-control studies.
25023406 2014 ERCC polymorphisms and prognosis of patients with osteosarcoma.
24990617 2014 Potentially functional variants in the core nucleotide excision repair genes predict survival in Japanese gastric cancer patients.
24802942 2014 Association between the XPG Asp1104His and XPF Arg415Gln polymorphisms and risk of cancer: a meta-analysis.
24782167 2014 Role of XRCC1 and ERCC5 polymorphisms on clinical outcomes in advanced non-small cell lung cancer.
24737519 2014 Effects of polymorphisms in the XRCC1, XRCC3, and XPG genes on clinical outcomes of platinum-based chemotherapy for treatment of non-small cell lung cancer.
24700531 2014 A novel homozygous ERCC5 truncating mutation in a family with prenatal arthrogryposis--further evidence of genotype-phenotype correlation.
24615519 2014 Genetic polymorphisms in XPG could predict clinical outcome of platinum-based chemotherapy for advanced non-small cell lung cancer.
24615090 2014 Polymorphisms of DNA repair-related genes with susceptibility and prognosis of prostate cancer.
24596032 2014 Genetic association between ERCC5 rs17655 polymorphism and lung cancer risk: evidence based on a meta-analysis.
24563277 2014 Association of single nucleotide polymorphisms of nucleotide excision repair genes with laryngeal cancer risk and interaction with cigarette smoking and alcohol drinking.
24354460 2015 Pellagra-like condition is xeroderma pigmentosum/Cockayne syndrome complex and niacin confers clinical benefit.
24192772 2013 Major efficacy of trabectedin in 2 metastatic osteosarcoma patients with wild-type Asp1104 ERCC5 tumor status.
24061640 2014 Quantitative assessment of the association between XPG Asp1104His polymorphism and bladder cancer risk.
23886164 2013 Predictive impact of common variations in DNA repair genes on clinical outcome of osteosarcoma.
23818366 Influence of polymorphisms in ERCC5, XPA and MTR DNA repair and synthesis genes in B-cell lymphoma risk. A case-control study in Spanish population.
23679317 2013 Single nucleotide polymorphisms in the NER pathway and clinical outcome of patients with bone malignant tumors.
23626689 2013 MTHFR Glu429Ala and ERCC5 His46His polymorphisms are associated with prognosis in colorectal cancer patients: analysis of two independent cohorts from Newfoundland.
23621222 2013 XPG is predictive gene of clinical outcome in advanced non-small-cell lung cancer with platinum drug therapy.
23534771 2013 Polymorphisms in DNA repair genes and risk of glioma and meningioma.
23464443 2012 SNPs of excision repair cross complementing group 5 and gastric cancer risk in Chinese populations.
23424205 2013 Effects of ?-glucan extracted from Agaricus blazei on the expression of ERCC5, CASP9, and CYP1A1 genes and metabolic profile in HepG2 cells.
23370536 2013 Characterization of three XPG-defective patients identifies three missense mutations that impair repair and transcription.
23330005 2013 Expression of XPG protein in human normal and tumor tissues.
23255472 2013 Novel XPG (ERCC5) mutations affect DNA repair and cell survival after ultraviolet but not oxidative stress.
23246108 2013 Study on bladder cancer susceptibility and genetic polymorphisms of XPC, XPG, and CYP in smokers and non-smokers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22982416 2012 Promoter polymorphisms in DNA repair gene ERCC5 and susceptibility to gastric cancer in Chinese.
22981091 2012 Association between polymorphisms of DNA repair gene ERCC5 and oral squamous cell carcinoma.
22848513 2012 Polymorphisms in the ERCC5 gene and risk of esophageal squamous cell carcinoma (ESCC) in Eastern Chinese populations.
22815677 2012 Association between the ERCC5 Asp1104His polymorphism and cancer risk: a meta-analysis.
22781116 2012 [Effect of XPG down-regulation gene expression towards the proliferation of epithelial ovarian cancer cells and its chemosensitivity to platinum].
22771116 2012 XPG and XPF endonucleases trigger chromatin looping and DNA demethylation for accurate expression of activated genes.
22659345 2012 Polymorphisms of DNA repair genes in Korean hepatocellular carcinoma patients with chronic hepatitis B: possible implications on survival.
22371296 2012 Polymorphisms in the XPG gene and risk of gastric cancer in Chinese populations.
22213216 2012 DNA repair genes XPC, XPG polymorphisms: relation to the risk of colorectal carcinoma and therapeutic outcome with Oxaliplatin-based adjuvant chemotherapy.
22108238 2012 Polymorphisms of XPG/ERCC5 and risk of squamous cell carcinoma of the head and neck.
21670956 2012 DNA repair genes polymorphism (XPG and XRCC1) and association of prostate cancer in a north Indian population.
21558802 2011 The DNA repair endonuclease XPG interacts directly and functionally with the WRN helicase defective in Werner syndrome.
21426550 2011 The effect of tobacco, XPC, ERCC2 and ERCC5 genetic variants in bladder cancer development.
21424776 2011 Lack of association between XPG Asp1104His and XPF Arg415Gln polymorphism and breast cancer risk: a meta-analysis of case-control studies.
21390047 2011 ERCC5 p.Asp1104His and ERCC2 p.Lys751Gln polymorphisms are independent prognostic factors for the clinical course of melanoma.
21347786 2011 DNA repair gene and MTHFR gene polymorphisms as prognostic markers in locally advanced adenocarcinoma of the esophagus or stomach treated with cisplatin and 5-fluorouracil-based neoadjuvant chemotherapy.
21287534 2011 ERCC5/XPG, ERCC1, and BRCA1 gene status and clinical benefit of trabectedin in patients with soft tissue sarcoma.
21269460 2011 Initial characterization of the human central proteome.
21216588 2011 Expression of DNA repair genes in ovarian cancer samples: biological and clinical considerations.
20868484 2010 Down-regulation of the nucleotide excision repair gene XPG as a new mechanism of drug resistance in human and murine cancer cells.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20725631 2010 True lies: the double life of the nucleotide excision repair factors in transcription and DNA repair.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20530453 2010 Possible associations of APE1 polymorphism with susceptibility and HOGG1 polymorphism with prognosis in gastric cancer.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20460046 2010 [Association of XPC and XPG polymorphisms with the risk of hepatocellular carcinoma].
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20391347 2010 DNA repair genes in endometriosis.
20233728 2010 Cis-acting genetic variation at an E2F1/YY1 response site and putative p53 site is associated with altered allele-specific expression of ERCC5 (XPG) transcript in normal human bronchial epithelium.
20232390 2011 Genetic variations of DNA repair genes and their prognostic significance in patients with acute myeloid leukemia.
20199546 2010 Interactions between ultraviolet light exposure and DNA repair gene polymorphisms may increase melanoma risk.
20183911 2010 Synergistic effects of polymorphisms in DNA repair genes and endogenous estrogen exposure on female breast cancer risk.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
19954624 2009 [Genetic susceptibility of single nucleotide polymorphism in MGMT to non-Hodgkin lymphoma].
19878615 2010 Modulation of nucleotide excision repair in human lymphocytes by genetic and dietary factors.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19740755 2009 Modulation of nucleotide excision repair by mammalian SWI/SNF chromatin-remodeling complex.
19693700 2010 Association and impact of XPG Asp 1104 His gene polymorphism in HIV 1 disease progression to AIDS among north Indian HIV seropositive individuals.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19444904 2009 Laryngeal cancer risk associated with smoking and alcohol consumption is modified by genetic polymorphisms in ERCC5, ERCC6 and RAD23B but not by polymorphisms in five other nucleotide excision repair genes.
19434073 2009 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19430706 2009 XPA A23G polymorphism is associated with the elevated response to platinum-based chemotherapy in advanced non-small cell lung cancer.
19414392 2009 Bladder cancer and polymorphisms of DNA repair genes (XRCC1, XRCC3, XPD, XPG, APE1, hOGG1).
19404856 2009 Frameshift mutation at mononucleotide repeat in ERCC5 in gastric carcinomas with microsatellite instability.
19350405 2009 Population study of genetic polymorphisms and superficial bladder cancer risk in Han-Chinese smokers in Shanghai.
19289372 2009 XPG mRNA expression levels modulate prognosis in resected non-small-cell lung cancer in conjunction with BRCA1 and ERCC1 expression.
19280628 2009 Genetic polymorphisms in DNA repair genes as modulators of Hodgkin disease risk.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19177501 2009 Chromosomal aberrations in railroad transit workers: effect of genetic polymorphisms.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19157633 2009 Polymorphisms in XRCC1 and XPG and response to platinum-based chemotherapy in advanced non-small cell lung cancer patients.
19124519 2009 DNA repair gene variants associated with benign breast disease in high cancer risk women.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19096231 2008 Susceptibility of XRCC3, XPD, and XPG genetic variants to cervical carcinoma.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19029193 2009 Red meat and poultry intake, polymorphisms in the nucleotide excision repair and mismatch repair pathways and colorectal cancer risk.
18990748 2008 International Lung Cancer Consortium: pooled analysis of sequence variants in DNA repair and cell cycle pathways.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18825991 [The evaluation of association between polymorphisms of DNA excision repair enzyme genes and risk of malignant tumors development in Siberian Group of Chemical Enterprises workers].
18767034 2008 Nucleotide excision repair polymorphisms may modify ionizing radiation-related breast cancer risk in US radiologic technologists.
18709642 2008 Nucleotide excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African Americans.
18701435 2008 Polygenic model of DNA repair genetic polymorphisms in human breast cancer risk.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18478970 2007 Single nucleotide polymorphism analysis of the nucleotide excision repair genes XPC, XPA, and XPG in the Indian population.
18320070 2008 DNA repair gene polymorphisms may be associated with prognosis of upper urinary tract transitional cell carcinoma.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18204222 2007 Single nucleotide polymorphisms in nucleotide excision repair genes XPA, XPD, XPG and ERCC1 in advanced colorectal cancer patients treated with first-line oxaliplatin/fluoropyrimidine.
18079701 2008 Sequential recruitment of the repair factors during NER: the role of XPG in initiating the resynthesis step.
18077223 2008 Hot topics in DNA repair: the molecular basis for different disease states caused by mutations in TFIIH and XPG.
18026184 2008 NAT2 and NER genetic variants and sporadic prostate cancer susceptibility in African Americans.
17932351 2007 Polymorphisms in nucleotide excision repair genes, polycyclic aromatic hydrocarbon-DNA adducts, and breast cancer risk.
17893230 2007 CEBPG regulates ERCC5/XPG expression in human bronchial epithelial cells and this regulation is modified by E2F1/YY1 interactions.
17855454 2007 Genetic variation in the DNA repair genes is predictive of outcome in lung cancer.
17825393 2007 Moving toward individualized therapy based on NER polymorphisms that predict platinum sensitivity in ovarian cancer patients.
17712032 2007 The association of DNA repair gene polymorphisms with the development and progression of renal cell carcinoma.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17575242 2007 Nucleotide excision repair pathway genes and oral premalignant lesions.
17494052 2007 Polymorphism discovery in 62 DNA repair genes and haplotype associations with risks for lung and head and neck cancers.
17476281 2007 Role of MTHFR (677, 1298) haplotype in the risk of developing secondary leukemia after treatment of breast cancer and hematological malignancies.
17466625 2007 XPG stabilizes TFIIH, allowing transactivation of nuclear receptors: implications for Cockayne syndrome in XP-G/CS patients.
17438655 Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers.
17374967 2006 Association between DNA repair gene polymorphisms and p53 alterations in Japanese patients with muscle-invasive bladder cancer.
17313739 2006 [Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers].
17299578 2007 Genetic polymorphisms in the nucleotide excision repair pathway and lung cancer risk: a meta-analysis.
17208056 2007 UV-induced apoptosis in XPG-deficient fibroblasts involves activation of CD95 and caspases but not p53.
17164380 2006 Polymorphisms in the DNA repair genes XPC, XPD, and XPG and risk of cutaneous melanoma: a case-control analysis.
17121236 2006 [Association between genetic polymorphism in xeroderma pigmentosum G gene and risks of laryngeal and hypopharyngeal carcinomas].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
16985021 2006 Polymorphisms in nucleotide excision repair genes and DNA repair capacity phenotype in sisters discordant for breast cancer.
16979838 2006 Single-nucleotide polymorphisms in base excision repair, nucleotide excision repair, and double strand break genes as markers for response to radiotherapy in patients with Stage I to II head-and-neck cancer.
16823510 2007 Breast cancer risk is not associated with polymorphic forms of xeroderma pigmentosum genes in a cohort of women from Washington County, Maryland.
16738949 2006 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma among women in Connecticut.
16646069 2006 Genetic polymorphisms of the XPG and XPD nucleotide excision repair genes in sarcoma patients.
16609022 2006 Polymorphisms in genes of nucleotide and base excision repair: risk and prognosis of colorectal cancer.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16536785 2006 A single-nucleotide polymorphism in the XPG gene, and tumour stage, grade, and clinical course in patients with nonmuscle-invasive neoplasms of the urinary bladder.
16507781 2006 Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16399771 2006 Polymorphisms in nucleotide excision repair genes, smoking and breast cancer in African Americans and whites: a population-based case-control study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16343742 2006 Influence of polymorphism in DNA repair and defence genes on p53 mutations in bladder tumours.
16284373 2005 Interindividual variation in nucleotide excision repair genes and risk of endometrial cancer.
16284370 2005 DNA repair polymorphisms and risk of colorectal adenomatous or hyperplastic polyps.
16258177 2006 Polymorphisms in nucleotide excision repair genes and risk of multiple primary melanoma: the Genes Environment and Melanoma Study.
16246722 2005 Recognition of RNA polymerase II and transcription bubbles by XPG, CSB, and TFIIH: insights for transcription-coupled repair and Cockayne Syndrome.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16167068 2006 Suppression of UV-induced apoptosis by the human DNA repair protein XPG.
16094634 2006 Polymorphism of Xeroderma Pigmentosum group G and the risk of lung cancer and squamous cell carcinomas of the oropharynx, larynx and esophagus.
16043197 2006 Genetic polymorphisms and possible gene-gene interactions in metabolic and DNA repair genes: effects on DNA damage.
15992842 2005 DNA repair and cyclin D1 polymorphisms and styrene-induced genotoxicity and immunotoxicity.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15746040 2005 Nucleotide excision repair gene polymorphisms and recurrence after treatment for superficial bladder cancer.
15590680 2005 The spacer region of XPG mediates recruitment to nucleotide excision repair complexes and determines substrate specificity.
15572672 2004 Definition of a short region of XPG necessary for TFIIH interaction and stable recruitment to sites of UV damage.
15494739 2005 No association between three xeroderma pigmentosum group C and one group G gene polymorphisms and risk of cutaneous melanoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358233 2004 Human NTH1 physically interacts with p53 and proliferating cell nuclear antigen.
15328203 2004 Irofulven cytotoxicity depends on transcription-coupled nucleotide excision repair and is correlated with XPG expression in solid tumor cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15082767 2004 Identification of the XPG region that causes the onset of Cockayne syndrome by using Xpg mutant mice generated by the cDNA-mediated knock-in method.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14729591 2004 Genetic polymorphisms in DNA repair genes and possible links with DNA repair rates, chromosomal aberrations and single-strand breaks in DNA.
14726017 2003 The XPG story.
14688016 2004 Polymorphisms in DNA repair and metabolic genes in bladder cancer.
12869423 2003 Relationship between XPG codon 1104 polymorphism and risk of primary lung cancer.
12865926 2003 Lack of involvement of nucleotide excision repair gene polymorphisms in colorectal cancer.
12644470 2003 Structural determinants for substrate binding and catalysis by the structure-specific endonuclease XPG.
12494477 2003 Single nucleotide polymorphisms in the XPG gene: determination of role in DNA repair and breast cancer risk.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060391 2002 Relationship of neurologic degeneration to genotype in three xeroderma pigmentosum group G patients.
11841555 2002 The founding members of xeroderma pigmentosum group G produce XPG protein with severely impaired endonuclease activity.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11266544 2001 The human XPG gene: gene architecture, alternative splicing and single nucleotide polymorphisms.
11259578 2001 Strong functional interactions of TFIIH with XPC and XPG in human DNA nucleotide excision repair, without a preassembled repairosome.
11228268 2001 Xeroderma pigmentosum group G with severe neurological involvement and features of Cockayne syndrome in infancy.
10583946 1999 Quality control by DNA repair.
10498399 1999 Expression in normal human tissues of five nucleotide excision repair genes measured simultaneously by multiplex reverse transcription-polymerase chain reaction.
10447254 1999 A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.
10408173 1999 Detection of chromatin-bound PCNA in mammalian cells and its use to study DNA excision repair.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10026181 1999 Conserved residues of human XPG protein important for nuclease activity and function in nucleotide excision repair.
9927729 1999 Nucleotide excision repair 3' endonuclease XPG stimulates the activity of base excision repairenzyme thymine glycol DNA glycosylase.
9305916 1997 The DNA repair endonuclease XPG binds to proliferating cell nuclear antigen (PCNA) and shares sequence elements with the PCNA-binding regions of FEN-1 and cyclin-dependent kinase inhibitor p21.
9096355 1997 A common mutational pattern in Cockayne syndrome patients from xeroderma pigmentosum group G: implications for a second XPG function.
8710877 1996 Ultraviolet-induced movement of the human DNA repair protein, Xeroderma pigmentosum type G, in the nucleus.
8652557 1996 Interactions involving the human RNA polymerase II transcription/nucleotide excision repair complex TFIIH, the nucleotide excision repair protein XPG, and Cockayne syndrome group B (CSB) protein.
8483505 1993 Identical defects in DNA repair in xeroderma pigmentosum group G and rodent ERCC group 5.
8483504 1993 Complementation of the DNA repair defect in xeroderma pigmentosum group G cells by a human cDNA related to yeast RAD2.
8413238 1993 Human ERCC5 cDNA-cosmid complementation for excision repair and bipartite amino acid domains conserved with RAD proteins of Saccharomyces cerevisiae and Schizosaccharomyces pombe.
8206890 1994 Isolation of active recombinant XPG protein, a human DNA repair endonuclease.
8090225 1994 XPG endonuclease makes the 3' incision in human DNA nucleotide excision repair.
8088806 1994 The human gene for xeroderma pigmentosum complementation group G (XPG) maps to 13q33 by fluorescence in situ hybridization.
8078765 1994 Human xeroderma pigmentosum group G gene encodes a DNA endonuclease.
7951246 1994 Mutations that disable the DNA repair gene XPG in a xeroderma pigmentosum group G patient.
7700386 1995 RPA involvement in the damage-recognition and incision steps of nucleotide excision repair.
7657672 1995 Human DNA repair excision nuclease. Analysis of the roles of the subunits involved in dual incisions by using anti-XPG and anti-ERCC1 antibodies.
7651464 1995 XPG protein has a structure-specific endonuclease activity.
7517009 1994 Nomenclature of human DNA repair genes.
7510366 1994 An ERCC5 gene with homology to yeast RAD2 is involved in group G xeroderma pigmentosum.
2276736 1990 Isolation of the functional human excision repair gene ERCC5 by intercosmid recombination.
1483924 1992 Precise localization of the excision repair gene, ERCC5, to human chromosome 13q32.3-q33.1 by direct R-banding fluorescence in situ hybridization.