Property Summary

NCBI Gene PubMed Count 734
PubMed Score 849.48
PubTator Score 889.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (790)

PMID Text
27166553 XPD SNPs are not associated with acute coronary syndromes in patients from Pakistan.
27069143 There exists no obvious contribution of XPD genotypes to tumor size.
26898429 The aim of this study was to investigate the association between polymorphisms of XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln and laryngeal cancer risk.
26823845 ERCC1 rs11615 and rs3212986 and ERCC2 rs13181 and rs1799793 polymorphisms were genotyped using the polymerase chain reaction restriction fragment length polymorphism
26782397 In conclusion, our study suggests that ERCC2 rs1799793 polymorphic variation could be used as a predictor for the prognosis of gastric cancer
26722489 Lys751Gln polymorphism of XPD gene can be used as one susceptibility factor for hepatocellular carcinoma
26649138 The frequency of the XPD 312Asn allele was significantly higher in T >/= 2 high grade than in T >/= 2 low grade tumors (p = 0.036); the ERCC6 1097Val/Val genotype was strongly associated with muscle-invasive tumors.
26627042 The minor allele of rs13181 polymorphism may confer a protect effect against radiotoxicity
26505449 study found that the ERCC2 Asn312Asp gene polymorphism likely plays an important role in influencing the chemotherapy response and overall survival of patients with osteosarcoma.
26505408 We aimed to conduct a meta-analysis to investigate the role of ERCC2 rs13181 on the risk of glioma
26482462 XPD polymorphisms (Lys751Gln) are strongly associated with advanced disease stage in myelodysplastic syndrome.
26384665 A tripartite lesion verification mechanism involving XPC, TFIIH, and XPA is necessary for efficient nucleotide excision repair.
26345951 the influence of four single nucleotide polymorphism in ERCC1 and ERCC2 on the response to cisplatin-based treatment and on clinical outcome in patients with osteosarcoma, was investigated.
26340423 identified four new conserved regions that function as hubs for TFIIH assembly and more than 35 conserved topological features within TFIIH, illuminating a network of interactions involved in TFIIH assembly and regulation of its activities
26295053 In conclusion, GSTs, EPHX1, and XPD are potential genetic factors for arsenic-induced skin cancers. The roles of these genes for arsenic-induced skin carcinogenesis need to be further evaluated.
26278177 Structural insight into the mechanism of TFIIH recognition by the acidic string of the nucleotide excision repair factor XPC has been uncovered.
26254397 The A allele of XPD codon 312 may contribute to gastric carcinogenesis and may be useful for early detection and prevention of gastric cancer.
26253951 ERCC1/2 SNP, predict radiation dose-response and potentially guide personalized radiotherapy in non-small cell lung cancer.
26191265 Suggest that ERCC1 rs3212986 and ERCC2 rs13181 gene polymorphism could influence the response to chemotherapy and clinical outcome of gastric cancer.
26149386 The results suggest that the XPG-TFIIH complex is involved in transcription elongation and that defects in this association may partly account for Cockayne syndrome in xeroderma pigmentosum group G/Cockayne Syndrome patients.
26125734 XPD751 SNPs may be predictive factors of prognosis in colorectal cancer patients receiving oxaliplatin and 5-fluorouracil chemotherapy.
26124006 the combined effects of BAG-1 and XPD polymorphisms on chemotherapy sensitivity and survival in patients with advanced non-small-cell lung cancer, which might be the important predictive markers for platinum-based chemotherapy efficacy.
26086338 Homozygous Lys/Lys (wildtype) genotype have 1.58 times higher odds of developing NPC compared to subjects with recessive combination of heterozygous Lys/Gln and homozygous Gln/Gln genotypes.
26001739 Single Nucleotide Polymorphism in XPC, XPD, XRCC1, and XRCC3 were associated with risk for head and neck squamous cell carcinomas.
26001533 Polymorphisms in ERCC2/XPD Asp312Asn may be associated with increased DNA adduct levels in the lung, especially among subjects with squamous cell carcinoma.
25969448 XPD plays crucial role(s) in protecting mitochondrial genome stability by facilitating an efficient repair of oxidative DNA damage in mitochondria.
25962431 results indicated that neither the Asp312Asn nor Lys751Gln XPD polymorphism was related to non-Hodgkin's lymphoma risk [meta-analysis]
25916209 The XPD Asp312Asn and APE1 Asp148Glu polymorphisms increase the risk for HNC.
25897079 XPD binding to Transcription Factor IIH is regulated by the Cytosolic iron-sulfur cluster assembly pathway
25873778 The XRCC1 Arg399Gln and XPD Lys751Gln single nucleotide polymorphisms predispose patients to age-related cataracts. (Meta-analysis)
25867436 Studies suggest that the ERCC1 protein rs3212986 polymorphism was associated with a higher susceptibility to glioma, but no significant association between ERCC2 protein rs13181 polymorphisms and glioma risk.
25835182 It has been found that the genotype 751Gln/Gln and allele Gln of ERCC2 gene and allele Asp of 312Asn/Asp polymorphism of ERCC2 gene may be associated with an increased risk of colorectal cancer.
25731027 The polymorphism of DNA repair genes XPD, XRCC1, OGG1, and ERCC6, life expectancy, and the inclination to smoke
25722380 Presence of XPG mutations may be poor indicator of prognosis in recurrent ovarian cancer.
25716912 TFIIH deletion mutations and protein instability in Xeroderma Pigmentosum.
25715450 the allele c.2251 A>C in the XPD gene correlated with a lower risk for bladder cancer and kidney cancer
25620205 Transcriptional differences found between various TFIIH subunit variants participate in the phenotypic variability observed among xeroderma pigmentosum, XP associated with Cockayne syndrome, and trichothiodystrophy individuals.
25605938 TFIIH-dependent MMP-1 transcriptional up-regulation in TTD is caused by an erroneous signaling mediated by retinoic acid receptors on the MMP-1 promoter and leads to hypersecretion of active MMP-1 enzyme
25596702 we evaluated the association of gene polymorphisms, including the repair genes of XRCC1, ERCC1, ERCC2 (XPD), and TP53, with RFS in patients with non-small cell lung cancer
25546681 XPD Lys751Gln polymorphism contributes to increased hepatocellular carcinoma susceptibility, especially in East Asian populations.
25542228 our results suggest that ERCC1 rs11615, ERCC2 rs1799793, and NBN rs1805794 polymorphisms in the DNA repair pathways may influence the response to chemotherapy and OS of gastric cancer.
25537294 meta-analyses results suggest that the XPD gene, but not the EGF gene, has contributed to cutaneous melanoma susceptibility, and XPD is a possible drug target
25537147 Data revealed the association of variant alleles of two polymorphisms, XRCC1 rs25487 and ERCC2 rs1799793, with increased risk of breast cancer, providing evidence for their involvement in the etiology of breast cancer in ethnical Russians.
25520091 XPD Lys751Gln polymorphism is associated with response to oxaliplatin-based chemotherapy in breast cancer.
25474887 XPD single nucleotide polymorphism and gene frequency in Russians, Tatars and Bashkirs.
25469049 Review/Meta-analysis: XPD Asp312Asn and Lys751Gln gene polymorphisms are associated with a significantly increased risk for esophageal cancer.
25422223 ERCC2 polymorphism did not show association with the development of non-Hodgkin lymphomas.
25391773 Our results confirmed that polymorphisms in XPC and XPD may be associated with the risk of colorectal cancer.
25311495 Data show increased risk of leukemia with XPCC protein (XPC) 939Gln/Gln genotype, ERCC2 protein (XPD) 751Gln allele may be protective against chronic myeloid leukemia and acute myeloid leukemia, and no significant risk for the ERCC5 protein (XPG) gene.
25285569 This meta-analysis indicates that XRCC1 Arg399Gln polymorphisms, but not XPD Lys751Gln polymorphisms, are associated with risk of age-related cataract.
25268380 XPD helicase is exclusively devoted to nucleotide excision repair and merely acts as a structural scaffold to maintain TFIIH integrity during transcription.
25209371 These findings suggest that potentially functional single nucleotide polymorphisms in ERCC2 may contribute to esophageal squamous cell carcinoma risk.
25169498 The present meta-analysis suggests that the XPD Lys751Gln polymorphism may contribute to the risk of cutaneous melanoma from currently available evidence
25155628 Polymorphism studies and linkage analysis in South Indian population compared to other HapMap show that genotype frequencies of ERCC1 (19007C > T, rs11615;8092C > A, rs3212986) and ERCC2 (Asp312Asn, rs1799793) genes are ethnic dependent.
25117088 observed no significant association between the rs 3916840 and rs 1799793 polymorphisms in ERCC2 and breast cancer risk
25113251 XPD Lys751Gln polymorphism is associated with the risk of cancer.
25096233 Somatic ERCC2 mutations correlate with complete response to cisplatin-based chemosensitivity in muscle-invasive urothelial carcinoma, and clinically identified mutations lead to cisplatin sensitivity in vitro.
25089939 OGG1 326 Ser/Cys and XPD 312 Asp/Asn heterozygous genotypes might be genetic markers modifying susceptibility to bladder cancer in Belarus.
25023406 the ERCC2 Lys751Gln and ERCC5 His46His polymorphisms might influence osteosarcoma prognosis.
24969862 ERCC2 rs13181 acts in an allele dose-dependent manner.
24955348 significant difference was observed in the variant genotype frequencies of the XPD Lys751Gln polymorphism between the patients with Chronic Myeloid Leukemia and control group (for variant homozygous genotypes, OR = 2.37; 95% CI = 1.20-4.67.
24938468 These results suggest that polymorphisms in XRCC1 and XPD may have functional significance in hepatocellular carcinoma
24933002 Polymorphism in XPD gene appears to be associated with the risk of prostate cancer.
24906341 Our meta-analysis suggested that the CC genotype of XPD Lys751Gln (A/C) SNP seemed to portend a decreased risk for ARC (age-related cataract) in Caucasian populations but not in Asian populations.
24892639 findings have suggested that APE1, XRCC3, XPD, and hOGG1 gene variants could facilitate the development of migraine disease.
24868140 The Asn/Asn genotype and Asn(3)(1)(2) allele of XPD polymorphism, as well as the Cys/Cys genotype and Cys(3)(2) allele of the OGG1 polymorphism, may be associated with increased risk of the development of age-related cataract in the Egyptian population.
24845027 XPD rs13181 may be associated with an increase in the risk of lung cancer among Caucasian populations
24841663 These results provide suggestive evidence of a favorable effect for the XPD 312Asp/Asp and XPD 751Lys/Lys genotypes with respect to overall survival rates in platinum-treated NSCLC patients.
24833529 The resukts of this study indicated that XPD/ERCC2 Lys751Gln polymorphism had the predictive value especially for the patients from the America and Europe.
24787743 Studies suggest that the Xeroderma pigmento-sum group D gene (XPD) 751Gln/Gln genotype was a low-penetrate risk factor for developing digestive tract cancers, especially in Asian populations.
24763305 the TT genotype of ERCC2 Lys751Gln polymorphism may decrease the risk of glioma in the Caucasian population.[meta-analysis]
24761895 XRCC1 Arg280His and XRCC1 Arg399Gln polymorphisms are not associated with nasopharyngeal carcinoma.
24716924 The combined Gln/Gln genotype of XRCC1 and XPD genes was significantly associated with increased risk for lung cancer.
24716840 Breast cancer patients carrying the MnSOD rs4880 A allele or XPD rs13181 AA genotype may have a reduced ability to scavenge ROS and repair the DNA damage generated by tamoxifen treatment.
24652592 These results suggest that XPD Lys751Gln polymorphism is not related to oral cancer risk.
24619222 Data indicate APEX1 nuclease single nucleotide polymorphism (SNPS) a tendency of association, but not Xeroderma Pigmentosum group D, X-ray repair cross-complementing group 1 and X-ray repair cross-complementing group 3 SNPS as the risk of preeclampsia.
24609361 XPB and XPD enrichment at G4 motifs characterizes specific signaling pathways and regulatory pathways associated with specific cancers
24590266 No relationships were found between XPD Lys751Gln polymorphism and both PFS and overall survival (all P>0.05).
24577548 No association was found between antioxidant capacity and DNA repair and polymorphisms of XPD 751 and XRCC1 399 in childhood acute lymphoblastic leukemia survivors
24556168 Conducted a comprehensive meta-analysis to assess the correlation between ERCC2 Lys751Gln polymorphism and an increased risk of lung cancer. Our research shows that ERCC2 Lys751Gln polymorphism carries an increased risk of developing lung cancer.
24535265 The current meta-analysis indicated that the Lys751Gln polymorphism in the XPD gene might be a risk factor for bladder cancer.
24531312 The SNPs of ERCC2 do not directly contribute to the susceptibility to colorectal cancer.
24510389 The meta-analysis results showed that XPD Lys751Gln polymorphism was borderline significantly associated with bladder cancersusceptibility for overall population
24504678 For ERCC2 Asp312Asn, individuals with the Asn allele were associated with a 1.29-fold (95 % CI=1.13-1.48) increased risk of bladder cancer
24486506 Significant acute leukemia risk effect of Lys751Gln genotype was found under the dominant model (OR=1.16; 95% CI=1.01-1.34; P=0.032). Review.
24443924 There is overall lack of association between XPD Lys751Gln polymorphism and head and neck cancer risk
24418926 analysis of mutations in the XPD gene in patients with XP complementation group D
24402573 the Lys751Gln polymorphism of the ERCC2 gene may be risk factors for triple-negative breast cancer development in Polish women.
24390613 genetic variations in the ERCC2 gene were associated with risk of esophageal squamous cell carcinoma (ESCC), and there was a significant interaction between gene polymorphisms and family history of cancer in the etiology of ESCC
24362511 This meta-analysis suggested that XPD A751C polymorphism likely contribute to cancer susceptibility in Indian population.
24347488 suggests that polymorphisms in XPD gene may contribute to bladder cancer susceptibility
24338713 meta-analysis suggested that the ERCC1 C118T, ERCC2 Asp312Asn, and Lys751Gln may be useful biomarkers to predict the clinical outcomes of the platinum-based chemotherapy in non-small cell lung cancer patients
24330540 Rs13181 in the ERCC2 gene might be associated with oral leukoplakia risk. [Meta-analysis]
24284041 Data indicate that xeroderma pigmentosum Group D protein (XPD) Lys751Gln CC polymorphic variant was associated with chemotherapy-induced cardiotoxicity.
24260311 None of the XPD Lys751Gln/Asp312Asn polymorphisms was associated with objective response.
24258710 ERCC2/XPD Arg156Arg polymorphism might be considered as a genetic risk factor for DLBCL in Egyptians, whether alone or conjoined with Lys751Gln.
24254311 indicate that the AA genotype of ERCC1 C8092A may be associated with a higher risk of adult glioma than the CA and CC genotypes and that the risk allele of ERCC2 K751Q confers a significant susceptibility to adult glioma, especially in Asian populations
24234258 meta-analysis suggested that the ERCC2 Asp312Asn polymorphism might be associated with increased risk of esophageal adenocarcinoma and a protective factor for esophageal squamous cell carcinoma
24157118 Lys751Gln XPD in Romanians. Association with sporadic colorectal cancer risk and different stages of carcinoma.
24140460 Haplotype ERCC2 rs3916874 polymorphism is associated with lung cancer risk.
24101192 The XPD Lys751Gln polymorphism significantly increased breast cancer risk
24083550 this meta-analysis suggested ERCC2 Asp312Asn polymorphism may increase the risk of lung cancer among Asians, whereas not among Caucasians
24023723 ERCC1 and ERCC2 functional SNPs may jointly affect OS in Caucasian gastric cancer patients.
23996617 No predictive roles of ERCC2 and XRCC1 expression were seen in analyzed patients with colorectal cancer.
23977265 XPD Asp312Asn polymorphism may function as a predictive biomarker on platinum-based chemotherapy in non-small cell lung cancer. (Meta-analysis)
23973729 A significant association between prostate cancer risk and XPD Asp312Asn polymorphism was found. (Review/Meta-analysis)
23959014 results indicate a distinct molecular profile of polymorphisms for the DNA repair genes XRCC1, XRCC3, OGG1 and XPD loci for CRS compared to other populations.
23884229 Mutations in the XPD gene is associated with brittle hair.
23800062 analysis of a novel mutation in XPD resulting in trichothiodystrophy as well as in xeroderma pigmentosum/Cockayne syndrome complex phenotypes
23771356 No overall association was observed between XPD Asp312Asn and prostate cancer risk.
23740134 XPDLys751Lys was associated with older age at breast cancer diagnosis than the Lys/Gln and Gln/Gln genotypes (65 vs 58 years, p < 0.0001).
23716550 No association exists between XPD Lys751Gln (rs13181) polymorphism and leukemic transformation in patients with primary myelofibrosis.
23700156 A three-order interaction among the polymorphic sites of XPD-751, XRCC1-399, and OGG1-326 is associated with lung adenocarcinoma risk.
23680703 ERCC2 rs13181TG/GG can prolong the survival time of gastric cancer, suggesting that the rs13181 polymorphism can be used as a predictor of overall survival of gastric cancer patients in a Chinese population.
23672414 not associated with leukaemic transformation in primary myelofibrosis
23669291 XPD gene polymorphic variants are associated with less DNA repair capacity in colorectal neoplasms.
23619945 A significant interaction of a DNA repair pathway gene ERCC2 and body mass index was observed in diffuse large B-cell lymphoma.
23617284 no significant differences were observed in progression-free survival or overall survival of advanced NSCLC according to XPD Lys751Gln genotypes (log-rank P > 0.05).
23593158 the variant genotypes of ERCC1 rs3212986 and ERCC2 rs238406 are associated with decreased repair efficiency of BPDE induced DNA damage, and may be predictive for an individual's DNA repair capacity in response to environmental carcinogens.
23534729 This meta-analysis suggested the XPD Asp312Asn polymorphism might be a potential biomarker of gastric cancer susceptibility in overall population.
23494240 ERCC2 Lys751Gln polymorphism is associated with susceptibility to cutaneous melanoma.
23464476 To determine the genotypes and allele frequencies of XRCC1, XRCC3 Thr241Met and OGG1 gene polymorphisms.
23435956 individuals whose expression of XRCC1, ERCC4, ERCC2, and ERCC1 are reduced may be at a higher risk of developing squamous intraepithelial lesion which eventually leads to invasive cervical carcinoma.
23397959 distributions of the XRCC3 Thr241Met, XPD Lys751Gln, and NQO1Pro 187Ser genotypes were not significantly different between patients and controls
23390054 study evaluated the correlation of XPD-Lys751Gln with outcome in 125 pancreatic cancer patients treated with gemcitabine-cisplatin polychemotherapy regimens and 90 treated with gemcitabine monotherapy; findings supported the association of XPD-Gln751Gln with greater resistance to cisplatin-induced damage
23382212 results identify the ARCH domain of XPD as a platform for the recruitment of CAK and as a molecular switch that might control TFIIH composition and play a role in conversion of TFIIH from a factor active in transcription to a factor involved in DNA repair
23317281 ERCC2 polymorphisms influence response to chemotherapy in bone tumors
23317245 Polymorphisms of XPD Lys751Gln are associated with colorectal cancer.
23271362 Polymorphisms of excision repair gene XPD Lys751Gln is not associated with hepatocellular carcinoma risk.
23271025 Studies indicate that xeroderma pigmentosum group D (XPD) and X-ray repair cross-complementing proteins 1 (XRCC1) and 3 (XRCC3) genes are involved in DNA repair and were found to be associated with head and neck squamous cell carcinoma (HNSCC).
23267107 dysregulation of Sirt1 function that results in transcriptional repression may be the cause of various severe clinical features in patients with XP-D/CS that cannot be explained by a DNA repair defect
23232694 Data show that abnormalities in osteopontin (OPN) induction in XPD (ERCC2) mutant fibroblasts indicate mutation-dependent aberrant transactivation of the nuclear receptor for vitamin D (VDR).
23229387 No statistically significant difference was observed for the genotype or allele frequencies of codon 312 between case and control groups (Xeroderma pigmentosum group D)
23221806 XPD mutations in trichothiodystrophy hamper COL6A1 expression.
23167354 The XPD 751Gln/Gln and Gln allele genotypes were associated with strong elevated susceptibility to hepatocellular carcinoma.
23098477 ERCC2 gene polymorphisms are associated with bone neoplasms.
23083890 XPB and XPD helicases differentially regulate TFIIH compositional change during nucleotide excision repair.
23044807 XPD gene played a vital role in the repair of DNA damage and protected against liver cancer.
23028604 Investigations demonstrate that XPD Asn312Asp SNP not the Gln751Lys SNP, might poorly increase PCa risk in Asians and Africans, moreover, this SNPs may associate with the tumor stage of PCa.
23028453 A systematic review and meta-analysis indicates that XPD Gln751Gln (CC) genotype and Asn312Asn (AA) genotype may seem to be more susceptible to gastric cancer in Asian populations but not in Caucasian populations.
22994779 GSTP1 Val/Val, ERCC1 C/C and ERCC2 G/G were also related to longer survival among patients with colon cancer.
22994751 XPD Asp312Asn polymorphism to be significantly associated with EC susceptibility.
22967467 XPD751 genetic polymorphisms may be associated with time to progression of advanced colorectal carcinoma patients treated with oxaliplatin as the first line chemotherapy. XPD751 SNP correlates with the clinical response to FOLFOX chemotherapy.
22938460 data indicated that polymorphisms in ERCC1 and XPD have a role in the susceptibility and survival of glioma
22932335 There might be an association of the XPD-751 polymorphism with higher free radical levels in age-related cataract disease.
22890093 XPD Asp312Asn polymorphism is associated with Prostate cancer (PCa) risk in Asians and hOGG1 Ser326Cys polymorphism is associated with PCa risk in Caucasians and Asians [meta-analysis]
22826098 A novel XPD mutation in a compound heterozygote; the mutation in the second allele is present in three homozygous patients with mild sun sensitivity.
22797977 Individuals carrying the unfavorable allele in the XPD gene are more susceptible to DNA damage induced by environmental and endogenous factors.
22760492 Expression of XPD was examinedin 84 normal cervical tissues and 148 cervical squamous cell carcinoma samples. Found a statistically significant difference in XPD expression level in cervical carcinoma vs. normal cervical tissue (Z = -7.302, P = 0.000).
22740138 Non-synonymous single nucleotide polymorphisms in XRCC3 and XPD genes in a healthy Tunision population suggest a close relatedness with Caucasians from European ancestry.
22644997 XPD Asp312Asn polymorphism was associated with an increased risk of prostate cancer in additive and recessive genetic models.
22617342 Mutations in XPD may influence the risk for prenatal complications in mothers of patients with trichothiodystrophy.
22608006 ERCC2 single nucleotide polymorphism, rs50872, is significantly related to overall survival.
22579466 The data suggested that XRCC1 Pro206Pro and ERCC2 Arg156Arg do not substantially influence breast cancer susceptibility among nonsmoking Chinese. The two loci were at weak linkage disequilibrium.
22537351 Association of single nucleotide polymorphisms in the genes ATM, GSTP1, SOD2, TGFB1, XPD and XRCC1 with risk of severe erythema after breast conserving radiotherapy.
22536360 XPD Asp312Asn polymorphism may not be a risk factor for developing head and neck cancer. [Meta-analysis]
22496165 A polymorphism in the XPD gene predisposes to leukemic transformation and new nonmyeloid malignancies in essential thrombocythemia and polycythemia vera.
22479369 Data show the predictive role of xeroderma pigmentosum group D (XPD) polymorphisms/haplotype on non-small cell lung cancer (NSCLC) prognosis in inoperable advanced NSCLC patients treated with platinum-based chemotherapy.
22427030 In head and neck neoplasms, distribution of XPD gene variants for YA did not offer statistical significance compared to controls. Heterozygous genotype AC was most frequently observed in three studied groups (YA = 49.4 %, YH = 59.7 %, and OP = 45.9 %).
22387547 XPD could suppress growth of hepatoma cells, up-regulate the expressions of P21 and Bax, and down-regulate the expressions of Bcl-2 and HBx through the P53 pathway.
22374424 XPD 751 Lys/ Lys might be a better prognostic marker of elderly or noncarcinoma NSCLC subgroup treated with platinum-based chemotherapy.
22351191 Highly significant differential distributions of haplotypes defined by both nine haplotype-tagging SNPs covering ERCC2 and PPP1R13L and fourteen haplotype-tagging SNPs covering ERCC2, PPP1R13L, and ERCC1 were found.
22345163 The ERCC2 gene variant Gln(751) was significantly associated to increased taxanes sensitivity.
22332413 a comparative study of allele frequencies of single nucleotide polymorphisms of ERCC2 and XRCC1 genes in population samples from European regions of Russia as well as in populations of Izhemsk and Priluzsk Komi and Yakuts was conducted.
22306120 Genotype of the OGG1-Ser326Cys polymorphism may be associated with increased risk of age-related cataract. However, in XRCC1-Arg399Gln, APE1-Asp148Glu, and XPD-Lys751Gln polymorphisms, there were no significant differences in gene frequencies.
22266871 inhibition of Gli1 by a specific shRNA inhibits the upregulation of c-jun Ser63/73, and also inhibits the upregulation of three genes essential to NER (ERCC1, XPD) and base excision repair (XRCC1).
22234153 Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta
22213390 GSTM1 and XPD variant alleles, independently as well as in combination may serve as important predictors of clinical outcome in radiotherapy-treated oral squamous cell carcinoma patients.
22194171 Increased malondialdehyde levels were found after tourniquet application in M allele carriers of the XPD gene; this could mean that M allele carriers are more prone to DNA damage due to oxidative activity.
22183307 Endogenous DNA damage levels were analyzed in relation to polymorphisms in genes encoding phase I detoxifying enzyme-CYP1A1, phase II detoxifying enzymes-GSTM1, GSTT1, GSTP1 and enzyme involved in nucleotide excision repair-XPD.
22183071 Data show that when the genotype frequencies of XPD and XRCC1 genes were examined in the patient and control groups, no significant difference was detected, while a significant association was found in XRCC4 polymorphisms.
22179996 XPD Lys751Gln polymorphism could be a prediction marker for risk of head and neck cancer.
22174317 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22116596 analysis of effect of XPD Lys/Gln polymorphism on risk prostate cancer on north Indian prostate cancer patients;found no significant increased risk of prostate cancer; statistically non-significant increase risk of prostate cancer was observed with Gln/Gln genotype (OR 1.62)
22110223 Single nucleotide polymorphism in XPD gene is associated with urothelial carcinoma.
22081374 this study demonstrated that reduced expression of XRCC1, XPD, and OGG1 is associated with more than twofold increased risk in squamous cell carcinoma of head and neck.
22052224 The xeroderma pigmentosum group D 751 C/C genotype was a significant prognostic factor of longer progression-free survival
22047709 No association was found between febrile neutropenia and/or mucositis in other XRCC1 gene polymorphisms and XPD polymorphisms
21987080 We found that haplotypes in APEX1, BRCA2, ERCC2, and RAD51 were significantly associated with total childhood acute lymphoblastic leukemia
21951951 This case reported the first case of AML involving XPD and XRCC3 polymorphisms from donor origin following allogeneic stem cell transplantation.
21950097 These data show that polymorphisms of the XPD and XRCC1 excision repair genes under study are accompanied by an elevated individual radio sensitivity in patients with Down syndrome.
21945240 There is a positive association of XPD Arg751Gln polymorphism with an increased risk of squamous cell carcinoma of head and neck.
21890746 Survival in stage I-II radiotherapy treated head and neck cancer did not depend on ERCC2 A35931C or CCND1 G870A genotype.
21793320 There is a significant association of XPD Asp312Asn polymorphism with breast cancer in Taiwanese patients.
21788800 XPD, XRCC1, and XRCC4 are all genes involved in the DNA repair process. They are responsible for regulation of apoptosis and proliferation during development.
21751184 ERCC2 rs50872 (TC genotype) in combination with XPA rs2808668 (TC genotype) and rs1800975 (AG genotype) was strongly associated with an increased risk of breast cancer.
21740187 XPD polymorphism may be a predisposing factor for carcinoma of urinary bladder, but the same cannot be said for RAD51 gene polymorphism.
21726821 XPD gene polymorphism is not associated with chemotherapy-induced neutropenia non-small-cell lung cancer.
21667112 Meta-analysis suggests that the XPD Lys751Gln genetic polymorphism may be a potential biomarker of esophageal cancer susceptibility in Chinese populations.
21643959 XPD gene is an important candidate gene for susceptibility to breast cancer, with gene-gene interaction between XPD(AA) + XRCC1(AG) polymorphism possibly associated with increased risk of breast cancer in Egyptian women.
21633601 XPD Lys751Gln polymorphism may be associated with increased risk of esophageal adenocarcinoma
21627375 XPD codon 751 polymorphism is not associated with response to chemptherapy in non-small cell lung cancer.
21617750 Defects in the DNA repair genes XRCC1 and XPD may possibly be associated with the progression of primary closed-angle glaucoma in male patients of Pakistani origin.
21614524 Meta-analysis suggests that two ERCC2 polymorphisms (Asp312Asn and Lys751Gln) may contribute to lung cancer susceptibility serving as low-penetrance risk factors.
21601580 data suggest that common genetic variations in ERCC1 may influence increased risk of smoking-related lung cancer and one of the causative effectors may locate around or within ERCC2
21599457 These results suggest that polymorphisms in XRCC1 codon 399 may be associated with the development of age-related cataract in Han Chinese.
21553048 An association between the frequency of the XPD Lys751Gln (rs13181) allele and risk for esophageal squamous cell carcinoma in Kazakh, Uygur and Han ethnic groups of Yili Prefecture, in Xinjiang, China.
21541661 This meta-analysis suggests that XPD Lys751Gln and Asp312Asn polymorphisms may not be associated with colorectal cancer development.
21463130 Data show there was no significant differences among the groups regarding XRCC1 codons 399 and 194 and ERCC2 codons 751 and 312 polymorphisms, but the TYMS 3R variant allele was significantly associated with a reduced risk of childhood ALL.
21426550 The XPC, ERCC2 and ERCC5 variants don't affect the tumors stage and grade.
21419115 Carriers of the homozygous ERCC2 751 Gln/Gln genotype may be at lower risk for squamous cell carcinoma of the head and neck.
21418965 In patients with malignant glioma the expressions of MGMT and ERCC(2) in the temozolomide-sensitive group are markedly lower than those in the non-sensitive group.
21404106 In patients receiving Erlotinib in combination with Gemcitabine and Capecitabine as a first-line therapy in metastatic/recurrent pancreatic cancer, ERCC2 expression was associated with longer progression free survival and overall survival
21390502 Association between OGG1 Ser326Cys, XPC Lys939Gln, XPD Lys751Gln polymorphisms and the susceptibility tho cancer and the oxidative stress status were evaluated.
21390047 ERCC5 codon 1104 and ERCC2 codon 751 polymorphisms are independent prognostic factors in patients with cutaneous melanoma.
21278243 ERCC1 and ERCC2 polymorphisms predict clinical outcomes of oxaliplatin-based chemotherapies in gastric and colorectal cancer
21264535 XPD may play an important role in cell apoptosis of hepatoma by inducing an over-expression of p53, but suppressing expressions of c-myc and cdk2
21245954 a polymorphism in XPD, but not in XRCC1, may be associated with the development of maturity onset cataract
21183201 exists in the Maharashtrian population of central India
21178723 ERCC2 gene polymorphism is associated with lung cancer.
21167544 These results suggest that TFIIH mediated cDNA degradation is a nuclear host defense against retroviral infection.
21129812 Our findings indicated that neither XPD Lys751Gln nor XRCC1 T-77C could be genetic determinant for prognosis of advanced non-small cell lung cancer patients treated with platinum-based chemotherapy
21075476 genetic polymorphisms is not a prognostic predictor of platinum-based chemotherapy outcomes in non-small cell lung cancer
21075476 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21057378 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21048041 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21047201 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20981556 both ERCC2 Lys751Gln and Asp312Asn polymorphisms might contribute to increased risk of gastric cancer among Asians.
20981556 Meta-analysis of gene-disease association. (HuGE Navigator)
20981350 Meta-analysis of gene-disease association. (HuGE Navigator)
20979431 Polymorphic variation in COMT Val158Met and XPD Lys751Gln may be important for esophageal squamous cell carcinomal susceptibility.
20979431 Observational study of gene-disease association. (HuGE Navigator)
20957144 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20935060 Observational study of gene-disease association. (HuGE Navigator)
20864414 Observational study of gene-disease association. (HuGE Navigator)
20863780 Three single nucleotide polymorphisms (SNPs) of xeroderma pigmentosum group D (XPD) and X-ray repair cross complement 1 (XRCC1) genes were genotyped in gastric cancer and control subjects in a population from Southwestern China.
20863780 Observational study of gene-disease association. (HuGE Navigator)
20850372 Observational study of gene-disease association. (HuGE Navigator)
20842450 This study demonstrates that the genetic variation at exon 10 of ERCC2 and haplotype AAA may be contributing factors in developing gastric cancer.
20842450 Observational study of gene-disease association. (HuGE Navigator)
20833695 A novel role for XPD protein in transcription-associated recombination (TAR), linking TAR with transcription-coupled repair.
20832885 Lys/Gln+Gln/Gln genotypes of XPD Lys751Gln polymorphism were also associated with a significantly decreased RIET risk (adjusted HR=0.55; 95% CI=0.32-0.96; P=0.030)in radiotherapy-treated lung neoplasms.
20817763 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20797633 Results indicate that the MMS19-XPD protein complex is required for proper chromosome segregation, an abnormality of which could contribute to the pathogenesis in some cases of xeroderma pigmentosum.
20734048 Observational study of gene-disease association. (HuGE Navigator)
20731661 Findings suggest that PARP1, XRCC1, MGMT, XPC, XPD and MSH2 SNP can be used as prognostic markers for patients with surgically resected early stage NSCLC.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20723587 The carriers of at least one variant hOGG1 (Cys) allele tended to higher oxidative damage to lymphocyte DNA than those with the wild genotype, while XPD23 (Gln/Gln) homozygotes were more susceptible to the induction of DNA strand breaks.
20723587 Observational study of gene-disease association. (HuGE Navigator)
20723346 Meta-analysis of gene-disease association. (HuGE Navigator)
20720310 Observational study of gene-disease association. (HuGE Navigator)
20708344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677654 XPD 312A allele is risk allele for lung cancer.
20677654 Meta-analysis of gene-disease association. (HuGE Navigator)
20651612 XPD Lys751Gln and Asp312Asn gene polymorphisms are associated with lung cancer.
20651612 Meta-analysis of gene-disease association. (HuGE Navigator)
20651370 MPO, urokinase, XPA and XPD polymorphisms are not related to leiomyoma susceptibilities.
20651370 Observational study of gene-disease association. (HuGE Navigator)
20649433 The carriers of the variant genotype of OGG1, XPC, or XPD did not associate with the increased risk of cancer progression, despite the increased oxidative stress in cancer patients.
20649433 Observational study of gene-disease association. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627704 this meta-analysis suggests that the ERCC2 Lys751Gln polymorphism may contribute to lung cancer susceptibility among Caucasians.
20627704 Meta-analysis of gene-disease association. (HuGE Navigator)
20627363 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571908 MUTYH Tyr165Cys, OGG1 Ser326Cys and XPD Lys751Gln polymorphisms may have a role in head neck cancer susceptibility
20571908 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20568454 XPD polymorphism Asp312Asn could contribute to altered risk of chronic benzene poisoning.
20568454 Observational study of gene-disease association. (HuGE Navigator)
20564624 These results suggest that genetic variants in the DNA repair pathways may be involved in GB carcinogenesis etiology.
20564624 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20559012 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20530453 Observational study of gene-disease association. (HuGE Navigator)
20530282 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20514470 Individuals who have the XPD 751 Gln allele may be at an increased risk for bladder cancer.
20514470 Observational study of gene-disease association. (HuGE Navigator)
20508946 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20504250 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20495366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20431719 XRCC1 codon 194 polymorphism causes decreased risk of developing pterygium, but codon 399 polymorphism increases risk. There is no correlation between pterygium and XRCC1 codon 107 and 280, XPA A23G, and XPD codon 751 polymorphisms.
20431719 Observational study of gene-disease association. (HuGE Navigator)
20429839 Observational study of gene-disease association. (HuGE Navigator)
20426969 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20391347 Observational study of gene-disease association. (HuGE Navigator)
20391138 Observational study of gene-disease association. (HuGE Navigator)
20385995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379847 Meta-analysis results suggest null associations of ERCC2 polymorphisms in the overall and the Caucasian subgroups, although some effects can be suggested for relatively smaller minority studies.
20379847 Meta-analysis of gene-disease association. (HuGE Navigator)
20379402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375340 Polymorphism in XPD codon 751 may be associated with the development of age-related macular degeneration
20375340 Observational study of gene-disease association. (HuGE Navigator)
20368715 Observational study of gene-disease association. (HuGE Navigator)
20354818 this meta-analysis suggests that the XPD Asn allele is a low-penetrant risk factor for developing lung cancer.
20354818 Meta-analysis of gene-disease association. (HuGE Navigator)
20351547 XPD polymorphism not associated with tumor response to platinum therapy for non-small-cell lung cancer
20351547 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20232390 Observational study of gene-disease association. (HuGE Navigator)
20232359 The results suggested that the polymorphisms of XPD codon 751 and XRCC4 codon 298 are associated with an increased risk of developing H. pylori-related gastric antrum adenocarcinoma among Guangxi population.
20232359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20229274 a combination of the XRCC1 399Gln allele with XRCC3 Thr/Thr genotype and the XPD 751Gln allele demonstrated the highest rectal cancer risk (OR = 3.52, 95% CI 1.43-9.44).
20229274 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20216541 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20204500 Meta-analysis suggests that the XPD 751Gln allele is a low-penetrant risk factor for developing breast cancer.
20204500 Meta-analysis of gene-disease association. (HuGE Navigator)
20199546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20183911 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170971 SNPs of XPD codon 751 genotype appear to be associated with lower risk of fibrosis in radiotherapy of breast neoplasms.
20170971 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20150366 Observational study of gene-disease association. (HuGE Navigator)
20143185 platinum-based chemotherapy sensitivity was not associated with polymorphism of XPD.
20127278 this meta-analysis provides an evidence that ERCC2 312Asn allele may have a protective effect for breast cancer development in Asians
20127180 Data suggest that the ERCC2 Gln/Gln and Lyc/Gln genotypes play a role in HIV-1 susceptibility and disease progression to AIDS.
20111903 our meta-analysis of XPD polymorphisms suggested 312N allele might act as a recessive allele in its association with breast cancer and the 751Q allele may play a plausible role in breast cancer development
20111903 Meta-analysis of gene-disease association. (HuGE Navigator)
20104979 XPD gene polymorphism is not associated with outcome of platinum-based chemotherapy for advanced non small cell lung cancers.
20070155 Results suggest a positive association of XRCC1 exon 9 and XPD exon 10 genotypes that may play an important role in the pathophysiology and may modulate the risk of prostate cancer.
20070155 Observational study of gene-disease association. (HuGE Navigator)
20061190 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20047592 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20003463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20003391 ERCC2 751 polymorphism may be a genetic risk modifier for lung adenocarcinoma in non-smoking females in China.
20003391 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19957595 DNA repair XPD312A allelic gene might increase the risk of Hepatocellular carcinoma.Interactions between HBsAg infection, smoking and XPD were observed in Hepatocellular carcinoma.
19957595 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19954624 Observational study of gene-disease association. (HuGE Navigator)
19934020 The broad range and severity of clinical features in xeroderma pigmentosum patients arise from a broad set of deficiencies in nucleotide excision repair and transcription that result from the combination of mutations found on both XPD alleles.
19922504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19919686 XPD Lys751Gln polymorphism is an important modulator of AFB1 related-HCC development in Guangxi population.
19919686 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19914098 There was no association between the XPD single nucleotide polymorphism alleles and prostate cancer risk.
19914098 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19908066 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19902366 Data show that although SNPs in BRCA2 and ERCC2 showed stronger associations with high Gleason score, results were not statistically significantly different between clinically aggressive and non-aggressive tumors.
19902366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19895736 The polymorphism of XPD at codon 312 might contribute to the etiology of gastric cancer. The haplotype AA is a critical risk factor of cancer susceptibility.
19895736 Observational study of gene-disease association. (HuGE Navigator)
19878615 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19858398 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19846926 The heterozygous and homozygous A allele of the XPD codon 312 may be responsible for bladder carcinogenesis and useful in the early detection and prediction of bladder cancer.
19846926 Observational study of gene-disease association. (HuGE Navigator)
19834688 investigation of association of XPD/ERCC2 polymorphisms with susceptibility to skin lesions due to environmental exposure to arsenic
19834688 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826048 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786980 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19762325 Observational study of gene-disease association. (HuGE Navigator)
19736055 We observed no association between genetic variation in ERCC2/XPD and risk of non-Hodgkin lymphoma (NHL); however, the XPD 751 Gln allele was associated with a two-fold decreased risk of diffuse large Bcell lymphoma, the major subtype of NHL
19736055 Observational study of gene-disease association. (HuGE Navigator)
19733688 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19724896 results indicate that SNPs in DNA repair genes (XRCC3241 and XPD751) influence the ICS and together with the expression of EGFR, Hsp70, Bax, and Bcl-2, they could predict the cisplatin sensitivity of head and neck cancer cell lines.
19707883 Observational study of gene-disease association. (HuGE Navigator)
19706757 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19706646 Meta-analysis of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19669592 The purpose of this study is to evaluate the role of XPD single nucleotide polymorphisms in bladder cancer susceptibility.
19669592 Observational study of gene-disease association. (HuGE Navigator)
19657998 Observational study of gene-disease association. (HuGE Navigator)
19642387 Meta-analysis of gene-disease association. (HuGE Navigator)
19638463 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19636001 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19620936 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19615095 Observational study of gene-disease association. (HuGE Navigator)
19592152 Polymorphic variants of APE1-148, XRCC1-194, XRCC1-399, and XPD-751 genes are not significant risk factors for pre-eclampsia development.
19592152 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19561388 The Lys751Gln polymorphism of the XPD gene is not associated with colorectal cancer in a Polish population.
19561388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19554020 XPD Lys751Gln polymorphism was a significant modifier of the oral contraceptive-squamous cell cardinoma association; potential relationship between OCs and SCC risk that could involve DNA repair pathways
19554020 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19492231 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19492231 meta-analysis suggests that the XPD (xeroderma pigmentosum complementary group D) Asp312Asn but NOT Lys751Gln polymorphism may be more genetically susceptible to bladder cancer development
19484764 Observational study of gene-disease association. (HuGE Navigator)
19470925 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19466538 Our findings do not suggest that ERCC2/XPD Arg156Arg contributes to breast cancer susceptibility in a Chinese population.
19458053 Study, for the first time, provides suggestive evidence of an effect of XPD p.Arg(156)Arg polymorphism on severe toxicity variability among platinum-treated non-small cell lung cancer patients.
19454010 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
19434073 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19434073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19432884 Patients with XPD Gln751 allele have a shorter progression-free and overall survivals.
19432884 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19429237 ERCC2 variants with high toenail arsenic had a slightly higher risk of bladder cancer, but estimates were imprecise.
19429237 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414392 Observational study of gene-disease association. (HuGE Navigator)
19406934 Observational study of gene-disease association. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19367277 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19362955 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19332728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19280628 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19274602 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19270000 Observational study of gene-disease association. (HuGE Navigator)
19257887 Observational study of gene-disease association. (HuGE Navigator)
19242824 The genetic variant (AA) of ERCC2312AA genotype is associated with high risk of tumor recurrence in superficial bladder cancer patients.
19242824 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19203783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19162321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19124519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19109787 overall genomic epidemiology review on associations between genes in the base excision repair pathway and cancer risk, focusing on genes encoding three key enzymes in this repair pathway: ADPRT, XRCC1, and XPD
19101034 No significant differences were observed among the study groups with regard to the XPD codon 312, XPD codon 751, XRCC1 codon 194, and XRCC1 codon 399 polymorphisms
19101034 Observational study of gene-disease association. (HuGE Navigator)
19096231 These findings offer evidence of the association between polymorphisms [ XPG Asp1104Asp (GG) and XPD Asn312Asn (AA)] and decreased risk for cervical carcinoma or cervical squamous cell carcinoma.
19096231 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19074750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19055600 the ERCC2/XPD functional polymorphisms analysed in this study showed no association in genetic susceptibility to systemic lupus erythematosus.
19055600 Observational study of gene-disease association. (HuGE Navigator)
19052983 interactions between DNA repair genes hMLH1, APEX1, MGMT, XRCC1 and XPD and electric transformers and power line distances from the houses of childhood acute leukemia patients revealed gene-environment interaction existed with XRCC1 Ex9+16 A allele
19052983 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19051060 Observational study of gene-disease association. (HuGE Navigator)
19041121 Reduced DNA repair capacity due to XPD Asp(312)Asn AA genotype might be a risk factor for bladder cancer
19041121 Observational study of gene-disease association. (HuGE Navigator)
19029193 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19027952 Frequencies of polymorphic variants of RAD51, XRCC3, NQO1, GSTA1, GSTM1, GSTT1, CYP3A4 and XPD enzymes were similar in patients and controls.
19027952 Observational study of gene-disease association. (HuGE Navigator)
19027756 Significantly the most chromatid breaks were found in elderly people both Lys/Lys homozygous in the XPD Lys751Gln genotype and C/C or A/A homozygous in the XPC IVS11 genotype (P<0.05).
19027756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990748 Meta-analysis of gene-disease association. (HuGE Navigator)
18977234 Observational study of gene-disease association. (HuGE Navigator)
18946634 Implications of XPD gene polymorphism in North Indian population: a comparative approach in different ethnic groups worldwide
18946634 Observational study of genotype prevalence. (HuGE Navigator)
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18838045 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18825991 Heterozygosis for the genes XPD was found to be a protective factor to malignant tumors in exposed person.
18825991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18817897 XPD-mutated fibroblasts derived from trichothiodystrophy and xeroderma pigmentosum patients is associated with nucleotide excision repair defects.
18797464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18778871 XPD c varian allele associated with a higher rate of lung cancer than XPD wild-type allele.
18767034 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18752184 The association of the XPD-Lys751Gln polymorphism with XPD genotypes with low histological grade, which is the most frequent pattern of sporadic breast carcinomas, was statistically significant (p = 0.05)
18752184 Observational study of gene-disease association. (HuGE Navigator)
18711149 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18709642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18701435 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18641418 Observational study of gene-disease association. (HuGE Navigator)
18637129 analysis of a novel c.2009delG mutation in XPD (ERCC2) in a patient with xeroderma pigmentosum [case report]
18636124 Observational study of gene-disease association. (HuGE Navigator)
18635523 Haplotypes of ERCC2 are significantly associated with high levels of DNA adducts compared with their most common haplotypes in normal human lymphocytes.
18635523 Observational study of gene-disease association. (HuGE Navigator)
18630471 Observational study of gene-disease association. (HuGE Navigator)
18627000 No significant effects of XRCC3 241Met polymorphisms was seen on the initial repair of MMS-induced DNA damage in human lymphocytes.
18627000 Observational study of gene-disease association. (HuGE Navigator)
18616887 ERCC1 and ERCC2 polymorphisms may have a role in idiopathic azoospermia in a Chinese population
18616887 Observational study of gene-disease association. (HuGE Navigator)
18603015 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18578568 suggest a model of how DNA is bound to the XPD protein, and can rationalize several of the mutations in the human XPD gene that lead to one of three severe diseases, xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy
18575735 Gln/Gln was a useful genetic marker for melanoma risk in the males, while Lys/Gln was an important predictor for melanoma progression.
18575735 Observational study of gene-disease association. (HuGE Navigator)
18569591 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18559563 Smoking, XPD and XRCC3 variants were the most important single-factor determinants of risk for pancreatic cancer.
18559563 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18544627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18534129 These results demonstrated that ERCC2 polymorphisms might be potential risk markers for breast cancer in the Chinese population.
18534129 Observational study of gene-disease association. (HuGE Navigator)
18509181 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18505590 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18495522 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18494946 Significantly higher ERCC2 mRNA expression was found in SCLC compared with NSCLC. There was no correlation between mRNA expression of the ERCC2 gene and chemosensitivity to cisplatin, carboplatin, or gemcitabine.
18483312 Observational study of genotype prevalence. (HuGE Navigator)
18478337 Polymorphisms of XPD are associated with esophageal adenocarcinoma risk.
18478337 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18470933 Persistence of repair proteins at unrepaired DNA damage distinguishes diseases with ERCC2 (XPD) mutations
18459458 the Lys751Gln polymorphism of XPD gene may be associated with the incidence of breast cancer.
18459458 Observational study of gene-disease association. (HuGE Navigator)
18454848 Study shows an increase in risk of breast cancer with no oral contraceptive users and with women exhibiting a waist-to-hip ratio (WHR) > 0.85 for Asn homozygous for ERCC2 312.
18454848 Observational study of gene-disease association. (HuGE Navigator)
18448328 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18442012 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18420361 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18415712 data indicate a possible role for XPD (Arg156Arg, C/A) polymorphisms in breast cancer susceptibility
18415712 Observational study of gene-disease association. (HuGE Navigator)
18415014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18394656 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18386788 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18365755 The aim of the study was to investigate NAT1, NAT2, GSTM1, GSTT1, GSTP1, SULT1A1, XRCC1, XRCC3 and XPD genetic polymorphisms, coffee consumption and risk of bladder cancer (BC) through a hospital-based case-control study
18365755 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18358500 Observational study of gene-disease association. (HuGE Navigator)
18349297 No significant association between the XPD Lys751Gln polymorphism and the risk of esophageal adenocarcinoma, Barrett's esophagus or reflux esophagitis.
18349297 Observational study of gene-disease association. (HuGE Navigator)
18349268 XPD is a candidate gene for cancer susceptibility regardless of environmental factors.
18349268 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18347182 Correlation of CDA, ERCC1, and XPD polymorphisms with response and survival in gemcitabine/cisplatin-treated advanced non-small cell lung cancer patients.
18347182 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18335219 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18320070 Observational study of gene-disease association. (HuGE Navigator)
18315909 The gene polymorphism of XPD (G23591A, G935931C) does not associate with the risk of developing non-Hodgkin's lymphoma in Shandong populations.
18315909 Observational study of gene-disease association. (HuGE Navigator)
18267032 We suggest that ERCC2 2251A>C alleles may be genetic predictors of early colorectal cancer relapse.
18267032 Observational study of gene-disease association. (HuGE Navigator)
18246963 The XPD polymorphism may have a significant role in the development of early-onset BCC in the Puerto Rican population.
18230301 Individuals with both XPD 751AA and 156 (CA+AA) genotypes are susceptible to radiation-induced chromosomal damage.
18230301 Observational study of gene-disease association. (HuGE Navigator)
18204222 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18196582 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18177646 Polymorphisms of XRCC4 promoter are associated with higher susceptibility of leiomyoma, and XPD promoter polymorphisms are not.
18177646 Observational study of gene-disease association. (HuGE Navigator)
18095557 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18085999 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18085999 The ERCC2 genotype appears as an important predictive factor of the survival of patients treated with oxaliplatin in first-line therapy for metastatic colorectal cancer.
18081788 Upregulation of ERCC1 and XPD protein expression was associated with resistance process to platinum-based chemotherapy in advanced epithelial ovarian cancer
18075460 Single nucleotide polymorphisms of the DNA repair gene XPD are potential modifiers of DNA repair capacity and of disease risk
18044339 The results suggest that the Lys751Gln polymorphism of XPD gene may not be linked with appearance and development of breast cancer.
18043991 These preliminary results suggest that XPD Lys751Gln and XRCC1 Arg399Gln polymorphisms may not be a significant risk factor for developing CAD.
18035379 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18006925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17953974 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17952468 Increasing numbers of either XPD or XRCC1 variant alleles were associated with shorter overall survival.
17952468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17932351 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17925548 Observational study of gene-disease association. (HuGE Navigator)
17913280 The XPD Lys751Glncc variant genotype was associated with higher risk for lung cancer among men and lower risk among women.
17913280 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17912469 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17912469 This study provided the first evidence that the XPD and XRCC1 polymorphisms contributed to the risk of developing idiopathic azoospermia in a selected Chinese population.
17898541 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17896209 Observational study of gene-disease association. (HuGE Navigator)
17825393 Observational study of gene-disease association. (HuGE Navigator)
17728339 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17712032 Observational study of gene-disease association. (HuGE Navigator)
17705814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17696747 Frequencies of XRCC1 and XPD polymorphisms observed in the present study with other populations revealed a distinctive nature of the South Indian population.
17696747 Observational study of genotype prevalence. (HuGE Navigator)
17695467 Observational study of gene-disease association. (HuGE Navigator)
17695467 Findings suggest that the heterozygous and homozygous A allele of the XPD codon 312 may be associated with the development of prostate cancer.
17693188 Observational study of gene-disease association. (HuGE Navigator)
17693188 Polymorphisms of the XPD gene is associated with bladder cancer
17687452 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17687452 The results indicate a reduced non-melanoma skin cancer risk in relation to XPD Asp312Asn and Lys751Gln variants; these polymorphisms may modify the association between non-melanoma skin cancer and arsenic exposure.
17685459 Observational study of gene-disease association. (HuGE Navigator)
17637462 Observational study of gene-disease association. (HuGE Navigator)
17630853 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17630376 Observational study of gene-disease association. (HuGE Navigator)
17630376 Polymorphisms in DNA repair genes may be important in the aetiology of stroke.
17627014 Observational study of gene-disease association. (HuGE Navigator)
17617021 Observational study of gene-disease association. (HuGE Navigator)
17614221 Observational study of gene-disease association. (HuGE Navigator)
17605237 Observational study of gene-disease association. (HuGE Navigator)
17604576 XPD polymorphisms in exon 6 and exon 23 are closely associated in the Caucasian population.
17593927 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17575242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17556064 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17556064 ERCC2 (Lys/Gln-Gln/Gln) genotype is marginally associated with increased risk of esophageal squamous cell carcinoma.
17549067 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17548684 Observational study of gene-disease association. (HuGE Navigator)
17531525 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17504986 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17504986 no association between XPD Lys751Gln genotype and clinical outcome of lung cancer was found
17498557 Observational study of gene-disease association. (HuGE Navigator)
17498557 Larger sample sizes are needed to elucidate the effects of ERCC2 polymorphisms on lung cancer risk in this northeastern Chinese population.
17479411 The expression levels of four genes (hMSH2, XRCC1, XPD, MGMT) present in peripheral blood mononuclear cells were significantly correlated with increased risk for esophageal squamous cell carcinoma.
17470448 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17470448 XPD polymorphisms modified the relationship between tendency to sunburn and skin lesions in an arsenic exposed population.
17466626 mechanism in which the helicase activity of XPB is not used for the opening and repair of damaged DNA, which is instead only driven by its ATPase activity, in combination with the helicase activity of XPD
17438703 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17438703 XPD (K751Q) polymorphism either individually or in combination with the XPC (K939Q) polymorphism modulates the risk of death in patients with urinary bladder neoplasms
17438655 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17412371 Observational study of gene-disease association. (HuGE Navigator)
17410042 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17409981 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17403617 ERCC2 polymorphisms have no measurable effect on nucleotide excision repair and basal transcription
17401013 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17374967 Observational study of gene-disease association. (HuGE Navigator)
17363013 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17363013 results showed no interaction between the XPD Lys751Gln, XPA A23G, and XPD Asp312Asn polymorphisms and the environmental factors for the development of colorectal cancer
17313739 Observational study of gene-disease association. (HuGE Navigator)
17299578 Meta-analysis of gene-disease association. (HuGE Navigator)
17290401 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17264068 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17242676 Observational study of gene-disease association. (HuGE Navigator)
17242676 Polymorphisms in XPD codon 751 and XRCC1 codon 399 were not associated with risk of POAG in a sample of Turkish patients.
17210993 Observational study of gene-disease association. (HuGE Navigator)
17197435 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17191090 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17164380 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17164360 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17158087 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17151930 data indicated that ERCC1 mRNA level is associated with CDDP, BCNU & VCR cytotoxicity, while ERCC2 expression is associated with BCNU cytotoxicity in gliomas; however, there was no association between ERCC1, ERCC2 SNP and chemotherapy drug response
17131345 Observational study of gene-disease association. (HuGE Navigator)
17111423 Observational study of genotype prevalence. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17063276 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17050553 Observational study of gene-disease association. (HuGE Navigator)
17050553 ERCC2 codon 751 Lys/Lys genotype is significantly associated with arsenic-induced premalignant hyperkeratosis.
17023576 Observational study of gene-environment interaction. (HuGE Navigator)
17023576 the XPD codon 751 glutamine-encoding variant significantly associates with risk of developing AML with a chromosome 5q deletion or a chromosome 7q deletion, but not with any other commonly recurring cytogenetic lesion
17018785 Observational study of gene-disease association. (HuGE Navigator)
17009404 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17009404 Xeroderma pigmentosum group D (XPD Lys751Gln) polymorphism may be an important marker in the prediction of clinical outcome to chemo-radiotherapy in resected gastric cancer patients.
16997330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16985021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16896002 Observational study of gene-disease association. (HuGE Navigator)
16889696 Observational study of gene-disease association. (HuGE Navigator)
16880786 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16875933 Observational study of gene-disease association. (HuGE Navigator)
16875718 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16875604 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16865671 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16865671 identification of polymorphisms in lung carcinoma of never smokers
16835333 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16835333 Single Nucleotide Polymorphism in the ERCC2 is associated with lung cancer
16824555 Observational study of gene-disease association. (HuGE Navigator)
16823510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16806697 Observational study of gene-disease association. (HuGE Navigator)
16806697 results suggest that the polymorphic variants of these NER genes do not contribute to the risk of developing AD.
16738949 Observational study of gene-disease association. (HuGE Navigator)
16707649 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
16685590 Observational study of gene-disease association. (HuGE Navigator)
16677755 Observational study of gene-disease association. (HuGE Navigator)
16672066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16652373 Observational study of gene-disease association. (HuGE Navigator)
16649224 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16646069 Observational study of genotype prevalence. (HuGE Navigator)
16646069 For XPD, both alleles were lost with a similar frequency
16638864 Observational study of gene-disease association. (HuGE Navigator)
16622263 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16609022 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16571649 Observational study of gene-disease association. (HuGE Navigator)
16571649 the XPD 751Gln allele may have a role in development of esophageal adenocarcinoma
16564556 Observational study of gene-disease association. (HuGE Navigator)
16542436 Observational study of gene-disease association. (HuGE Navigator)
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16492913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16475125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16465622 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16458430 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16458430 Results show that the XPD gene polymorphism could be a genetic risk modifier for smoking-related pancreatic cancer.
16435384 Observational study of gene-disease association. (HuGE Navigator)
16407418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16399771 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16373199 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16369171 Observational study of gene-disease association. (HuGE Navigator)
16351803 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16343742 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16324877 Observational study of gene-disease association. (HuGE Navigator)
16319991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16319991 Polymorphisms of the DNA repair genes XPD is associated with breast cancer
16311243 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16308313 Observational study of gene-disease association. (HuGE Navigator)
16284380 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16284373 Observational study of gene-disease association. (HuGE Navigator)
16284370 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16280050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16258177 Observational study of gene-disease association. (HuGE Navigator)
16258177 results provide further evidence for a role of XPD in the etiology of melanoma
16217922 Observational study of gene-environment interaction. (HuGE Navigator)
16214924 Observational study of gene-disease association. (HuGE Navigator)
16212814 Observational study of gene-disease association. (HuGE Navigator)
16195237 Observational study of gene-disease association. (HuGE Navigator)
16172101 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16150943 Observational study of gene-disease association. (HuGE Navigator)
16061005 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16054878 A review of the possible relationship between ERCC2 polymorphisms, reduced DNA repair and increased cancer risk.
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16038584 Observational study of gene-disease association. (HuGE Navigator)
16037119 Observational study of gene-disease association. (HuGE Navigator)
16030124 Observational study of gene-disease association. (HuGE Navigator)
16030112 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16002061 Observational study of gene-disease association. (HuGE Navigator)
16000577 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15992842 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15971256 Observational study of gene-disease association. (HuGE Navigator)
15941969 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15936590 Observational study of gene-disease association. (HuGE Navigator)
15914277 Observational study of gene-disease association. (HuGE Navigator)
15914210 Observational study of gene-disease association. (HuGE Navigator)
15896456 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15887293 Observational study of gene-disease association. (HuGE Navigator)
15886521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15886521 The combined effect of ERCC2 Asp(312)Asn and ERCC4 Ser(835)Ser genotypes might be associated with breast cancer risk in Korean women
15885892 Observational study of gene-disease association. (HuGE Navigator)
15878910 Observational study of gene-disease association. (HuGE Navigator)
15849729 Observational study of gene-disease association. (HuGE Navigator)
15837542 Observational study of gene-disease association. (HuGE Navigator)
15834925 Observational study of gene-disease association. (HuGE Navigator)
15834925 Polymorphisms in ERCC2 are associated with the development of oligodendrogliomas
15824172 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15824159 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15802298 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15776433 Observational study of gene-disease association. (HuGE Navigator)
15776433 XPD single nucleotide polymorphisms mediate susceptibility to cutaneous basal cell carcinoma
15764301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15764301 relationship between genetic polymorphism of XRCC1 and ERCC2 and DNA damage in polycyclic aromatic hydrocarbon exposed workers; no significant associations between G23591A and A35931C polymorphisms of ERCC2 were found
15754315 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15754315 An associative interaction between XPD protein and CCND1 genetic polymorphisms, tobacco exposure, and cancer risk.
15746160 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15746040 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15729710 Observational study of genetic testing. (HuGE Navigator)
15709194 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15679883 Observational study of gene-disease association. (HuGE Navigator)
15679883 The role of a genetic polymorphism of the XPD gene in risk for colorectal cancer was investigated.
15615908 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15598761 Observational study of gene-disease association. (HuGE Navigator)
15598760 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15534626 Observational study of genotype prevalence. (HuGE Navigator)
15523694 Observational study of gene-disease association. (HuGE Navigator)
15471894 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15381366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15381366 effect of XPD codon 751 and 312 polymorphisms on the risk of esophageal squamous cell carcinoma
15339847 XPD codon 751 glutamine variant protects against myeloid cell death after chemotherapy.
15333465 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15298945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15298945 Patients with nonmelanoma skin cancer who have the variant XPD Gln allele are increased risk of developing second primary cancer.
15277258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15213713 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15199549 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15199548 Observational study of gene-disease association. (HuGE Navigator)
15173214 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15159312 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
15140544 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15090466 Observational study of gene-disease association. (HuGE Navigator)
15090466 XPD polymorphisms is associated with breast cancer
14735199 Observational study of gene-disease association. (HuGE Navigator)
14729591 Observational study of gene-disease association. (HuGE Navigator)
14688016 Observational study of gene-disease association. (HuGE Navigator)
14668933 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14652287 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14625810 Observational study of genotype prevalence. (HuGE Navigator)
14624713 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14569024 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
14568296 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12883749 Observational study of gene-disease association. (HuGE Navigator)
12865926 Observational study of gene-disease association. (HuGE Navigator)
12844488 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12820975 Basal transcription defect discriminates between xeroderma pigmentosum and trichothiodystrophy in XPD patients.
12749816 Observational study of gene-disease association. (HuGE Navigator)
12749816 DNA repair gene XPD may influence the risk of arsenic-induced premalignant hyperkeratotic skin lesions
12740916 Observational study of gene-disease association. (HuGE Navigator)
12740916 The Asp312Asn and Lys751Gln polymorphisms in the XPD gene may alter DNA repair capacity. The hypothesis that these 2 XPD polymorphisms are associated with risk of lung cancer was confirmed in a large hospital-based, case-control study among Chinese.
12692111 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12692111 Cumulative cigarette smoking plays an important role in altering the direction and magnitude of the associations between the XRCC1 and ERCC2 polymorphisms and lung cancer risk.
12645871 The results show a significant association between BCC and the A-allele of a polymorphism in ERCCI exon4 (Odds ratio 12;95% Confidence Interval 1.17-124; p(chi2, two-side) = 0.019) and to a lesser extent with XPD exon6 (p = 0.06).
12579497 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12579497 Findings indicate that the Asp312Asn and Lys751Gln polymorphisms in the XPD locus are associated with the risk of lung Squamous Cell Carcinoma (SCC) but not lung adenocarcinoma or esophageal SCC in this Chinese population.
12552590 Observational study of gene-disease association. (HuGE Navigator)
12552590 the XPD variant alleles may be associated with an increased frequency of smoking-related p53 mutations in lung tumors, presumably due to reduced DNA repair proficiency.
12458209 Structural and functional characterization of the human DNA repair helicase XPD
12451985 XPD protein levels correlate with resistance to alkylating agents in human tumor cell lines
12435843 ERCC2/XPD gene polymorphisms and cancer risk. Review.
12399122 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12393447 Observational study of gene-disease association. (HuGE Navigator)
12393447 The genotype distribution of the XPD gene does not indicate a role for base excision repair in the development of therapy-related acute myeloblastic leukemia
12376500 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12359753 XPD overexpression in SK-MG-4 cells leads to cisplatin resistance without affecting the nucleotide excision repair activity or UV light sensitivity of the cell.
12243508 Observational study of gene-disease association. (HuGE Navigator)
12220217 Observational study of gene-disease association. (HuGE Navigator)
12151350 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12151350 polymorphism and risk of lung cancer in a Chinese population
12124811 Observational study of gene-disease association. (HuGE Navigator)
12124811 Polymorphisms of DNA repair genes XRCC1 and XPD and their associations with risk of esophageal squamous cell carcinoma in a Chinese population.
12115580 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12110342 Observational study of gene-disease association. (HuGE Navigator)
11960912 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11960912 The XPD variant alleles are associated with increased aromatic DNA adduct level and lung cancer risk.
11891028 Polymorphisms in XPD protein is associated with risk of primary lung cancer
11888908 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11872635 Observational study of gene-disease association. (HuGE Navigator)
11872635 we investigated the association between the repair phenotype of ultraviolet (UV)-induced damage and genotypes of three DNA repair genes, XPC and XPD [involved in nucleotide excision repair (NER)] and XRCC1 [involved in base excision repair (BER)].
11751380 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11751380 A Xeroderma pigmentosum group D gene polymorphism predicts clinical outcome to platinum-based chemotherapy in patients with advanced colorectal cancer.
11532866 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11375896 Observational study of gene-disease association. (HuGE Navigator)
11319176 Observational study of gene-disease association. (HuGE Navigator)
11309287 Observational study of gene-disease association. (HuGE Navigator)
11245433 Observational study of gene-disease association. (HuGE Navigator)
11238179 Observational study of gene-disease association. (HuGE Navigator)
11133811 Observational study of gene-disease association. (HuGE Navigator)
10866664 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
10438593 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
10082552 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
10066804 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9765201 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9651670 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9570510 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9334327 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9311822 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9184228 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9121429 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9054383 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
8934526 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
8849451 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
8628270 HIV-1 Rev interacting protein, excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKL      1 - 70
IYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTAS     71 - 140
YVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYH    141 - 210
YLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQR    211 - 280
LRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVV    281 - 350
QESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP    351 - 420
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCL    421 - 490
CPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN    491 - 560
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQS    561 - 630
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH    631 - 700
LTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL              701 - 760
//

Text Mined References (739)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
27166553 2016 Association of Polymorphisms (rs 1799782, rs25489 and rs25487) in XRCC1 and (rs 13181) XPD genes with Acute Coronary Artery Syndrome in Subjects from Multan, Pakistan.
27069143 2016 Contribution of DNA Repair Xeroderma Pigmentosum Group D Genotypes to Colorectal Cancer Risk in Taiwan.
26898429 2016 Single nucleotide polymorphisms in DNA repair genes and the risk of laryngeal cancer: A meta-analysis.
26823845 2015 Prognostic value of ERCC1 and ERCC2 gene polymorphisms in patients with gastric cancer receiving platinum-based chemotherapy.
26782397 2015 Genetic variability of ERCC1 and ERCC2 influences treatment outcomes in gastric cancer.
26722489 2015 A meta-analysis of xeroderma pigmentosum gene D Ls751Gln polymorphism and susceptibility to hepatocellular carcinoma.
26649138 2016 The Cellular Response to Oxidatively Induced DNA Damage and Polymorphism of Some DNA Repair Genes Associated with Clinicopathological Features of Bladder Cancer.
26627042 2015 ERCC2 polymorphisms and radiation-induced adverse effects on normal tissue: systematic review with meta-analysis and trial sequential analysis.
26505449 2015 Influence of ERCC2 gene polymorphisms on the treatment outcome of osteosarcoma.
26505408 2015 Association between the ERCC2 rs13181 polymorphism and the risk of glioma: a meta-analysis.
26482462 2016 Association of XPD (Lys751Gln) and XRCC1 (Arg280His) gene polymorphisms in myelodysplastic syndrome.
26384665 2015 Tripartite DNA Lesion Recognition and Verification by XPC, TFIIH, and XPA in Nucleotide Excision Repair.
26345951 2015 Association between ERCC1 and ERCC2 gene polymorphisms and chemotherapy response and overall survival in osteosarcoma.
26340423 2015 Architecture of the Human and Yeast General Transcription and DNA Repair Factor TFIIH.
26295053 2015 Association of Environmental Arsenic Exposure, Genetic Polymorphisms of Susceptible Genes, and Skin Cancers in Taiwan.
26278177 2015 Structural Insight into the Mechanism of TFIIH Recognition by the Acidic String of the Nucleotide Excision Repair Factor XPC.
26254397 2015 Contribution of DNA Repair Xeroderma Pigmentosum Group D Genotype to Gastric Cancer Risk in Taiwan.
26253951 2015 Use a survival model to correlate single-nucleotide polymorphisms of DNA repair genes with radiation dose-response in patients with non-small cell lung cancer.
26191265 2015 Genetic variability of genes in NER pathway influences the treatment outcome of gastric cancer.
26149386 2015 Regulation of Transcription Elongation by the XPG-TFIIH Complex Is Implicated in Cockayne Syndrome.
26125734 2015 Relationship between DNA repair gene XPD751 single-nucleotide polymorphisms and prognosis of colorectal cancer.
26124006 2015 Association between polymorphisms of BAG-1 and XPD and chemotherapy sensitivity in advanced non-small-cell lung cancer patients treated with vinorelbine combined cisplatin regimen.
26086338 2015 Homozygous Wildtype of XPD K751Q Polymorphism Is Associated with Increased Risk of Nasopharyngeal Carcinoma in Malaysian Population.
26001739 2015 DNA repair genes XPC, XPD, XRCC1, and XRCC3 are associated with risk and survival of squamous cell carcinoma of the head and neck.
26001533 2015 Polymorphisms in ERCC1 and ERCC2/XPD genes and carcinogen DNA adducts in human lung.
25969448 2015 XPD localizes in mitochondria and protects the mitochondrial genome from oxidative DNA damage.
25962431 2015 Association of the Asp312Asn and Lys751Gln polymorphisms in the XPD gene with the risk of non-Hodgkin's lymphoma: evidence from a meta-analysis.
25916209 2015 XPD, APE1, and MUTYH polymorphisms increase head and neck cancer risk: effect of gene-gene and gene-environment interactions.
25897079 2015 The Association of the Xeroderma Pigmentosum Group D DNA Helicase (XPD) with Transcription Factor IIH Is Regulated by the Cytosolic Iron-Sulfur Cluster Assembly Pathway.
25873778 2015 XRCC1 and XPD genetic polymorphisms and susceptibility to age-related cataract: a meta-analysis.
25867436 2015 Systematic review on the association between ERCC1 rs3212986 and ERCC2 rs13181 polymorphisms and glioma risk.
25835182 2015 An association of selected ERCC2 and ERCC5 genes polymorphisms, the level of oxidative DNA damage and its repair efficiency with a risk of colorectal cancer in Polish population.
25731027 2014 [The polymorphism of DNA repair genes XPD, XRCC1, OGG1, and ERCC6, life expectancy, and the inclination to smoke].
25722380 2015 Effect of BRCA1 and XPG mutations on treatment response to trabectedin and pegylated liposomal doxorubicin in patients with advanced ovarian cancer: exploratory analysis of the phase 3 OVA-301 study.
25716912 2015 Constructive rescue of TFIIH instability by an alternative isoform of XPD derived from a mutated XPD allele in mild but not severe XP-D/CS.
25715450 2014 [DNA repair XRCC1, XPD genes polymorphism as associated with the development of bladder cancer and renal cell carcinoma].
25620205 2015 TFIIH subunit alterations causing xeroderma pigmentosum and trichothiodystrophy specifically disturb several steps during transcription.
25605938 2015 TFIIH-dependent MMP-1 overexpression in trichothiodystrophy leads to extracellular matrix alterations in patient skin.
25596702 2015 Prognostic value of ERCC1, ERCC2, XRCC1, and TP53 single nucleotide polymorphisms in patients with early-stage non-small cell lung cancer.
25546681 2014 Association between XPD Lys751Gln and Asp312Asn polymorphisms and hepatocellular carcinoma risk: a systematic review and meta-analysis.
25542228 2015 Genetic polymorphisms of DNA repair pathways influence the response to chemotherapy and overall survival of gastric cancer.
25537294 2015 Association of EGF rs4444903 and XPD rs13181 polymorphisms with cutaneous melanoma in Caucasians.
25537147 2016 Polymorphisms in DNA repair genes and breast cancer risk in Russian population: a case-control study.
25520091 2014 The XPD Lys751Gln polymorphism has predictive value in colorectal cancer patients receiving oxaliplatin-based chemotherapy: a systemic review and meta-analysis.
25474887 2013 [Polymorphism of DNA repair genes (XRCC1, XRCC3, XPC, XPD, XPA) in ethnic groups from Republic of Bashkortostan].
25469049 2014 Xeroderma pigmentosum group D polymorphisms and esophageal cancer susceptibility: a meta-analysis based on case-control studies.
25422223 2014 Comprehensive assessment of associations between ERCC2 Lys751Gln/Asp312Asn polymorphisms and risk of non- Hodgkin lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
25391773 2015 Polymorphisms in nucleotide excision repair genes and susceptibility to colorectal cancer in the Polish population.
25311495 2015 Polymorphisms in XPC, XPD and XPG DNA repair genes and leukemia risk in a Tunisian population.
25285569 2015 Polymorphisms of DNA repair genes XPD (Lys751Gln) and XRCC1 (Arg399Gln), and the risk of age-related cataract: a meta-analysis.
25268380 2014 In TFIIH, XPD helicase is exclusively devoted to DNA repair.
25209371 2014 Potentially functional polymorphisms in the ERCC2 gene and risk of esophageal squamous cell carcinoma in Chinese populations.
25169498 2014 XPD Lys751Gln and Asp312Asn polymorphisms and susceptibility to skin cancer: a meta-analysis of 17 case-control studies.
25155628 2014 Frequency distribution of DNA repair genes ERCC1 and ERCC2 polymorphisms in South Indian healthy population.
25117088 2014 Polymorphisms in the DNA repair gene ERCC2/XPD and breast cancer risk: a HapMap-based case-control study among Han Women in a Chinese less-developed area.
25113251 2014 Association between the XPD/ERCC2 Lys751Gln polymorphism and risk of cancer: evidence from 224 case-control studies.
25096233 2014 Somatic ERCC2 mutations correlate with cisplatin sensitivity in muscle-invasive urothelial carcinoma.
25089939 2014 Polymorphism of DNA repair genes OGG1, XRCC1, XPD and ERCC6 in bladder cancer in Belarus.
25023406 2014 ERCC polymorphisms and prognosis of patients with osteosarcoma.
24969862 2014 Association between ERCC2 polymorphisms and glioma risk: a meta-analysis.
24955348 2014 Polymorphism of XRCC1, XRCC3, and XPD genes and risk of chronic myeloid leukemia.
24938468 2014 Implication of polymorphisms in DNA repair genes with an increased risk of hepatocellular carcinoma.
24933002 2014 Common variants of xeroderma pigmentosum genes and prostate cancer risk.
24906341 2014 Association between DNA repair genes (XPD and XRCC1) polymorphisms and susceptibility to age-related cataract (ARC): a meta-analysis.
24892639 2014 DNA repair gene variants in migraine.
24868140 2014 Polymorphisms of DNA repair genes OGG1 and XPD and the risk of age-related cataract in Egyptians.
24845027 2014 Comprehensive assessment of the association between XPD rs13181 polymorphism and lung cancer risk.
24841663 2014 Association of xeroderma pigmentosum group D (Asp312Asn, Lys751Gln) and cytidine deaminase (Lys27Gln, Ala70Thr) polymorphisms with outcome in Chinese non-small cell lung cancer patients treated with cisplatin-gemcitabine.
24833529 2012 ERCC1 and XPD/ERCC2 polymorphisms' predictive value of oxaliplatin-based chemotherapies in advanced colorectal cancer has an ethnic discrepancy: a meta-analysis.
24787743 2014 The effect of XPD polymorphisms on digestive tract cancers risk: a meta-analysis.
24763305 2014 Association of ERCC1 C8092A and ERCC2 Lys751Gln polymorphisms with the risk of glioma: a meta-analysis.
24761895 2014 Distribution and haplotype associations of XPD Lys751Gln, XRCC1 Arg280His and XRCC1 Arg399Gln polymorphisms with nasopharyngeal carcinoma in the Malaysian population.
24716924 2014 Interaction of XRCC1 and XPD gene polymorphisms with lifestyle and environmental factors regarding susceptibility to lung cancer in a high incidence population in North East India.
24716840 2014 MnSOD rs4880 and XPD rs13181 polymorphisms predict the survival of breast cancer patients treated with adjuvant tamoxifen.
24652592 2014 XPD Lys751Gln polymorphism is not associated with oral cancer risk: evidence from a meta-analysis.
24619222 2014 Polymorphisms in DNA repair genes (APEX1, XPD, XRCC1 and XRCC3) and risk of preeclampsia in a Mexican mestizo population.
24609361 2014 G quadruplexes are genomewide targets of transcriptional helicases XPB and XPD.
24590266 2014 XRCC1 and XPD genetic polymorphisms and clinical outcomes of gastric cancer patients treated with oxaliplatin-based chemotherapy: a meta-analysis.
24577548 2015 DNA Repair Gene Polymorphisms and Their Relation With DNA Damage, DNA Repair, and Total Antioxidant Capacity in Childhood Acute Lymphoblastic Leukemia Survivors.
24556168 2014 Association between ERCC2 Lys751Gln polymorphism and lung cancer risk: a meta-analysis involving 23,370 subjects.
24535265 2014 The association between the Lys751Gln polymorphism in the XPD gene and the risk of bladder cancer.
24531312 2014 Association of ERCC1 and ERCC2 polymorphisms with colorectal cancer risk in a Chinese population.
24510389 2014 Association between XPD Lys751Gln polymorphism and bladder cancer susceptibility: an updated and cumulative meta-analysis based on 6,836 cases and 8,251 controls.
24504678 2014 Complex association between ERCC2 gene polymorphisms, gender, smoking and the susceptibility to bladder cancer: a meta-analysis.
24486506 2014 The effect of XPD/ERCC2 Lys751Gln polymorphism on acute leukemia risk: a systematic review and meta-analysis.
24443924 2014 Association of XPD Lys751Gln polymorphism with head and neck cancer susceptibility: evidence from 11,443 subjects.
24418926 2014 Differences in clinical phenotype among patients with XP complementation group D: 3D structure and ATP-docking of XPD in silico.
24402573 2014 Single nucleotide polymorphisms (SNPs) of ERCC2, hOGG1, and XRCC1 DNA repair genes and the risk of triple-negative breast cancer in Polish women.
24390613 2014 Association of single nucleotide polymorphisms in ERCC2 gene and their haplotypes with esophageal squamous cell carcinoma.
24362511 2014 Meta-analysis on the association of nucleotide excision repair gene XPD A751C variant and cancer susceptibility among Indian population.
24347488 2014 Xeroderma pigmentosum complementation group D (XPD) gene polymorphisms contribute to bladder cancer risk: a meta-analysis.
24338713 2014 The association between the ERCC1/2 polymorphisms and the clinical outcomes of the platinum-based chemotherapy in non-small cell lung cancer (NSCLC): a systematic review and meta-analysis.
24330540 2013 Association between polymorphisms in ERCC2 gene and oral cancer risk: evidence from a meta-analysis.
24284041 2014 XPD gene polymorphisms and the effects of induction chemotherapy in cytogenetically normal de novo acute myeloid leukemia patients.
24260311 2013 Polymorphisms in XPD gene could predict clinical outcome of platinum-based chemotherapy for non-small cell lung cancer patients: a meta-analysis of 24 studies.
24258710 2013 Excision repair cross-complementing group 2/Xeroderma pigmentousm complementation group D (ERCC2/XPD) genetic variations and susceptibility to diffuse large B cell lymphoma in Egypt.
24254311 2014 Association between ERCC1 C8092A and ERCC2 K751Q polymorphisms and risk of adult glioma: a meta-analysis.
24234258 2014 A pooled analysis of the ERCC2 Asp312Asn polymorphism and esophageal cancer susceptibility.
24157118 Lys751Gln XPD and Arg399Gln XRCC1 in Romanians. Association with sporadic colorectal cancer risk and different stages of carcinomas.
24140460 2013 HapMap-based study identifies risk sub-region on chromosome 19q13.3 in relation to lung cancer among Chinese.
24101192 2014 XPD Asp312Asn and Lys751Gln polymorphisms and breast cancer susceptibility: a meta-analysis.
24083550 2014 Polymorphism of ERCC2 Asp312Asn with lung cancer risk: evidence from 20,101 subjects.
24023723 2013 ERCC1 and ERCC2 variants predict survival in gastric cancer patients.
23996617 2013 Predictive value of ERCC1, ERCC2, and XRCC1 overexpression for stage III colorectal cancer patients receiving FOLFOX-4 adjuvant chemotherapy.
23977265 2013 Predictive value of XPD polymorphisms on platinum-based chemotherapy in non-small cell lung cancer: a systematic review and meta-analysis.
23973729 2013 Genetic polymorphisms of xeroderma pigmentosum group D gene Asp312Asn and Lys751Gln and susceptibility to prostate cancer: a systematic review and meta-analysis.
23959014 2013 DNA Repair Genes XRCC1, XRCC3, XPD, and OGG1 Polymorphisms among the Central Region Population of Saudi Arabia.
23884229 2013 Analysis of mutations in the XPD gene in a patient with brittle hair.
23800062 2013 Functional and molecular genetic analyses of nine newly identified XPD-deficient patients reveal a novel mutation resulting in TTD as well as in XP/CS complex phenotypes.
23771356 Genetic polymorphisms of xeroderma pigmentosum group D and prostate cancer risk: a meta-analysis.
23740134 2014 Role of XRCC3, XRCC1 and XPD single-nucleotide polymorphisms in survival outcomes following adjuvant chemotherapy in early stage breast cancer patients.
23716550 2013 No association between the XPD Lys751Gln (rs13181) polymorphism and disease phenotype or leukemic transformation in primary myelofibrosis.
23700156 2013 Polymorphisms of DNA repair genes XPD, XRCC1, and OGG1, and lung adenocarcinoma susceptibility in Chinese population.
23680703 2013 A genetic variant in ERCC2 is associated with gastric cancer prognosis in a Chinese population.
23672414 2013 The ERCC2 Gln/Gln polymorphism at codon 751 is not associated with leukaemic transformation in primary myelofibrosis.
23669291 2013 The influence of XPD, APE1, XRCC1, and NBS1 polymorphic variants on DNA repair in cells exposed to X-rays.
23619945 2013 Polymorphisms in DNA repair pathway genes, body mass index, and risk of non-Hodgkin lymphoma.
23617284 2013 Predictive effect of XPA and XPD polymorphisms on survival of advanced NSCLC patients treated with platinum-based chemotherapy: a three-dimensional (3-D), polyacrylamide gel-based DNA microarray method.
23593158 2013 ERCC1 and ERCC2 haplotype modulates induced BPDE-DNA adducts in primary cultured lymphocytes.
23534729 2013 XPD Lys751Gln and Asp312Asn polymorphisms and gastric cancer susceptibility: a meta-analysis of case-control studies.
23494240 2013 Comprehensive assessment of the association of ERCC2 Lys751Gln polymorphism with susceptibility to cutaneous melanoma.
23464476 2012 DNA repair gene polymorphisms at XRCC1, XRCC3, XPD, and OGG1 Loci in the hyderabad population of India.
23435956 2013 Decreased expression of DNA repair genes (XRCC1, ERCC1, ERCC2, and ERCC4) in squamous intraepithelial lesion and invasive squamous cell carcinoma of the cervix.
23397959 2013 The genotype distribution of the XRCC1, XRCC3, and XPD DNA repair genes and their role for the development of acute myeloblastic leukemia.
23390054 2013 Prognostic factors in gemcitabine-cisplatin polychemotherapy regimens in pancreatic cancer: XPD-Lys751Gln polymorphism strikes back.
23382212 2013 ARCH domain of XPD, an anchoring platform for CAK that conditions TFIIH DNA repair and transcription activities.
23317281 2012 Glutathione S-transferase P1 and DNA polymorphisms influence response to chemotherapy and prognosis of bone tumors.
23317245 2012 Association between polymorphisms of XRCC1 Arg399Gln and XPD Lys751Gln genes and prognosis of colorectal cancer in a Chinese population.
23271362 2013 Polymorphisms of excision repair gene XPD Lys751Gln and hOGG1 Ser326Cys might not be associated with hepatocellular carcinoma risk: a meta-analysis.
23271025 2012 Polymorphisms in human DNA repair genes and head and neck squamous cell carcinoma.
23267107 2013 Sirt1 suppresses RNA synthesis after UV irradiation in combined xeroderma pigmentosum group D/Cockayne syndrome (XP-D/CS) cells.
23232694 2013 Abnormal XPD-induced nuclear receptor transactivation in DNA repair disorders: trichothiodystrophy and xeroderma pigmentosum.
23229387 2013 Association between XPD gene polymorphisms and esophageal squamous cell carcinoma.
23221806 2013 XPD mutations in trichothiodystrophy hamper collagen VI expression and reveal a role of TFIIH in transcription derepression.
23167354 2012 Association of XPD and XRCC1 genetic polymorphisms with hepatocellular carcinoma risk.
23108145 2013 Genome-wide association study reveals novel genetic determinants of DNA repair capacity in lung cancer.
23098477 2012 Association of four ERCC1 and ERCC2 SNPs with survival of bone tumour patients.
23083890 2012 Lack of CAK complex accumulation at DNA damage sites in XP-B and XP-B/CS fibroblasts reveals differential regulation of CAK anchoring to core TFIIH by XPB and XPD helicases during nucleotide excision repair.
23044807 2013 Association of XRCC1, XRCC3, and XPD genetic polymorphism with an increased risk of hepatocellular carcinoma because of the hepatitis B and C virus.
23028604 2012 Impact of two common xeroderma pigmentosum group D (XPD) gene polymorphisms on risk of prostate cancer.
23028453 2012 The effect of XPD/ERCC2 polymorphisms on gastric cancer risk among different ethnicities: a systematic review and meta-analysis.
22994779 2012 GSTP1, ERCC1 and ERCC2 polymorphisms, expression and clinical outcome of oxaliplatin-based adjuvant chemotherapy in colorectal cancer in Chinese population.
22994751 2012 Association between XPD Asp312Asn polymorphism and esophageal cancer susceptibility: a meta-analysis.
22967467 2012 [Relationship between single nucleotide polymorphism in repair gene XPD751 and prognosis in colorectal carcinoma patients].
22938460 2012 DNA repair gene ERCC1 and XPD polymorphisms predict glioma susceptibility and prognosis.
22932335 2012 [Explore the genotype characteristics of DNA repair enzyme XRCC1 and XPD in the lens epithelium associated with free radical level in the age-related cataract patients].
22890093 2012 Polymorphisms in XPD and hOGG1 and prostate cancer risk: a meta-analysis.
22826098 2012 A novel XPD mutation in a compound heterozygote; the mutation in the second allele is present in three homozygous patients with mild sun sensitivity.
22797977 2012 XPD gene rs13181 polymorphism and DNA damage in human lymphocytes.
22760492 2012 Nucleotide excision repair gene subunit XPD is highly expressed in cervical squamous cell carcinoma.
22740138 2012 An interethnic variability and a functional prediction of DNA repair gene polymorphisms: the example of XRCC3 (p.Thr241>Met) and XPD (p.Lys751>Gln) in a healthy Tunisian population.
22678361 2012 MMS19 links cytoplasmic iron-sulfur cluster assembly to DNA metabolism.
22644997 2012 XPD Asp312Asn polymorphism is a risk factor for prostate cancer.
22617342 2012 Effect of mutations in XPD(ERCC2) on pregnancy and prenatal development in mothers of patients with trichothiodystrophy or xeroderma pigmentosum.
22608006 2012 Clinical significance of ERCC2 haplotype-tagging single nucleotide polymorphisms in patients with unresectable non-small cell lung cancer treated with first-line platinum-based chemotherapy.
22579466 2012 No evidence of association between the synonymous polymorphisms in XRCC1 and ERCC2 and breast cancer susceptibility among nonsmoking Chinese.
22537351 2012 Association of single nucleotide polymorphisms in the genes ATM, GSTP1, SOD2, TGFB1, XPD and XRCC1 with risk of severe erythema after breast conserving radiotherapy.
22536360 2012 Associations between XPD Asp312Asn polymorphism and risk of head and neck cancer: a meta-analysis based on 7,122 subjects.
22496165 2012 A polymorphism in the XPD gene predisposes to leukemic transformation and new nonmyeloid malignancies in essential thrombocythemia and polycythemia vera.
22479369 2012 Effect of polymorphisms in XPD on clinical outcomes of platinum-based chemotherapy for Chinese non-small cell lung cancer patients.
22427030 2013 Polymorphisms of DNA repair genes and risk of squamous cell carcinoma of the head and neck in young adults.
22387547 2012 XPD could suppress growth of HepG2.2.15 and down-regulate the expression of hepatitis B virus x protein through P53 pathway.
22374424 2012 Association of XRCC3 and XPD751 SNP with efficacy of platinum-based chemotherapy in advanced NSCLC patients.
22351191 2012 Hapmap-based evaluation of ERCC2, PPP1R13L, and ERCC1 and lung cancer risk in a Chinese population.
22345163 2012 Deciphering the role of the ERCC2 gene polymorphism on anticancer drug sensitivity.
22332413 2011 [Polymorphisms of DNA repair genes ERCC2 and XRCC1 in populations of Russia].
22306120 2012 Genetic polymorphisms in DNA repair genes OGG1, APE1, XRCC1, and XPD and the risk of age-related cataract.
22266871 2012 Inhibition of Gli1 results in altered c-Jun activation, inhibition of cisplatin-induced upregulation of ERCC1, XPD and XRCC1, and inhibition of platinum-DNA adduct repair.
22234153 2012 Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta.
22213390 2012 Polymorphisms in GSTM1 and XPD genes predict clinical outcome in advanced oral cancer patients treated with postoperative radiotherapy.
22194171 2011 XPD and hOGG1 gene polymorphisms in reperfusion oxidative stress.
22183307 2012 Common polymorphisms in CYP1A1, GSTM1, GSTT1, GSTP1 and XPD genes and endogenous DNA damage.
22183071 2011 DNA repair genes polymorphisms in multiple myeloma: no association with XRCC1 (Arg399Gln) polymorphism, but the XRCC4 (VNTR in intron 3 and G-1394T) and XPD (Lys751Gln) polymorphisms is associated with the disease in Turkish patients.
22179996 2011 Association between XPD Lys751Gln polymorphism and risk of head and neck cancer: a meta-analysis.
22116596 2012 Impact of XPD gene polymorphism on risk of prostate cancer on north Indian population.
22110223 2011 Association of hOGG1 and XPD polymorphisms with urothelial carcinoma in Taiwan.
22081374 2012 Reduced expression of DNA repair genes (XRCC1, XPD, and OGG1) in squamous cell carcinoma of head and neck in North India.
22052224 2011 Association of cytidine deaminase and xeroderma pigmentosum group D polymorphisms with response, toxicity, and survival in cisplatin/gemcitabine-treated advanced non-small cell lung cancer patients.
22047709 2012 DNA repair gene XPD and XRCC1 polymorphisms and the risk of febrile neutropenia and mucositis in children with leukemia and lymphoma.
21987080 2011 Haplotypes of DNA repair and cell cycle control genes, X-ray exposure, and risk of childhood acute lymphoblastic leukemia.
21951951 2011 Acute myeloid leukemia of donor origin after allogeneic stem cell transplantation from a sibling who harbors germline XPD and XRCC3 homozygous polymorphisms.
21950097 [The peculiarities of polymorphism of XPD and XRCC1 repair genes in cells of Down and Ehlers-Danlo syndrome patients characterized by increased radiosensitivity].
21945240 2012 Associated risk of XRCC1 and XPD cross talk and life style factors in progression of head and neck cancer in north Indian population.
21890746 2011 Effects of ERCC2 Lys751Gln (A35931C) and CCND1 (G870A) polymorphism on outcome of advanced-stage squamous cell carcinoma of the head and neck are treatment dependent.
21793320 2010 Significant association of XPD Asp312Asn polymorphism with breast cancer in Taiwanese patients.
21788800 2011 No association between DNA repair gene (XPD, XRCC1, and XRCC4) polymorphisms and nonsyndromic microtia in Turkish patients.
21751184 2012 SNP-SNP interactions between DNA repair genes were associated with breast cancer risk in a Korean population.
21740187 2012 Susceptibility of XPD and RAD51 genetic variants to carcinoma of urinary bladder in North Indian population.
21726821 2011 Chemotherapy-induced neutropenia does not correlate with DNA repair gene polymorphisms and treatment efficacy in advanced non-small-cell lung cancer patients.
21667112 2012 XPD Lys751Gln polymorphism and esophageal cancer susceptibility: a meta-analysis of case-control studies.
21643959 2012 Impact of DNA repair genes polymorphism (XPD and XRCC1) on the risk of breast cancer in Egyptian female patients.
21633601 2011 XPD Lys751Gln polymorphism and esophageal cancer risk: a meta-analysis involving 2288 cases and 4096 controls.
21627375 2011 Lack of any relationship between chemotherapy toxicity in non-small cell lung cancer cases and polymorphisms in XRCC1 codon 399 or XPD codon 751.
21617750 2011 XRCC1 and XPD DNA repair gene polymorphisms: a potential risk factor for glaucoma in the Pakistani population.
21614524 2012 Association of ERCC2/XPD polymorphisms and interaction with tobacco smoking in lung cancer susceptibility: a systemic review and meta-analysis.
21601580 2011 HapMap-based study of a region encompassing ERCC1 and ERCC2 related to lung cancer susceptibility in a Chinese population.
21599457 2011 Polymorphisms of the DNA repair genes XPD and XRCC1 and the risk of age-related cataract development in Han Chinese.
21553048 2012 Analysis of XPD genetic polymorphisms of esophageal squamous cell carcinoma in a population of Yili Prefecture, in Xinjiang, China.
21541661 2011 Lack of association between XPD Lys751Gln and Asp312Asn polymorphisms and colorectal cancer risk: a meta-analysis of case-control studies.
21463130 2011 Impact of thymidylate synthase promoter and DNA repair gene polymorphisms on susceptibility to childhood acute lymphoblastic leukemia.
21426550 2011 The effect of tobacco, XPC, ERCC2 and ERCC5 genetic variants in bladder cancer development.
21419115 2011 DNA repair gene ERCC2 polymorphisms and risk of squamous cell carcinoma of the head and neck.
21418965 2011 [Comparison of MGMT and ERCC? expression in temozolomide for the treatment of malignant glioma drug resistance and their genetic relationship].
21404106 2012 A phase II trial of erlotinib in combination with gemcitabine and capecitabine in previously untreated metastatic/recurrent pancreatic cancer: combined analysis with translational research.
21390502 2011 DNA repair enzyme polymorphisms and oxidative stress in a Turkish population with gastric carcinoma.
21390047 2011 ERCC5 p.Asp1104His and ERCC2 p.Lys751Gln polymorphisms are independent prognostic factors for the clinical course of melanoma.
21278243 2011 ERCC1 and ERCC2 polymorphisms predict clinical outcomes of oxaliplatin-based chemotherapies in gastric and colorectal cancer: a systemic review and meta-analysis.
21269460 2011 Initial characterization of the human central proteome.
21264535 2012 The role of XPD in cell apoptosis and viability and its relationship with p53 and cdk2 in hepatoma cells.
21245954 2011 Polymorphisms in two DNA repair genes (XPD and XRCC1)--association with age related cataracts.
21183201 2011 DNA repair gene polymorphisms at XRCC1, XRCC3, XPD, and OGG1 loci in Maharashtrian population of central India.
21178723 2011 ERCC2/XPD polymorphisms and lung cancer risk.
21167544 2011 XPB mediated retroviral cDNA degradation coincides with entry to the nucleus.
21129812 2011 Assessment of XPD Lys751Gln and XRCC1 T-77C polymorphisms in advanced non-small-cell lung cancer patients treated with platinum-based chemotherapy.
21075476 2011 No evidence of an association of ERCC1 and ERCC2 polymorphisms with clinical outcomes of platinum-based chemotherapies in non-small cell lung cancer: a meta-analysis.
21057378 2011 Multiple genetic polymorphisms in the prediction of clinical outcome of metastatic colorectal cancer patients treated with first-line FOLFOX-4 chemotherapy.
21048041 2011 Pharmacogenetic interaction analysis for the efficacy of systemic treatment in metastatic colorectal cancer.
21047201 2010 Nucleotide excision repair gene polymorphisms may predict acute toxicity in patients treated with chemoradiotherapy for bladder cancer.
20981556 2011 ERCC2 Lys751Gln and Asp312Asn polymorphisms and gastric cancer risk: a meta-analysis.
20981350 2010 Lung cancer risk and genetic polymorphisms in DNA repair pathways: a meta-analysis.
20979431 2011 Polymorphisms of COMT and XPD and risk of esophageal squamous cell carcinoma in a population of Yili Prefecture, in Xinjiang, China.
20957144 2010 Interactions between exposure to environmental polycyclic aromatic hydrocarbons and DNA repair gene polymorphisms on bulky DNA adducts in human sperm.
20935060 2010 Genetic modifiers of carcinogen DNA adducts in target lung and peripheral blood mononuclear cells.
20864414 2010 Polymorphisms of nucleotide-excision repair genes may contribute to sperm DNA fragmentation and male infertility.
20863780 2011 Association of DNA repair gene XRCC1 and XPD polymorphisms with genetic susceptibility to gastric cancer in a Chinese population.
20850372 2010 Influence of genetic polymorphisms on frequency of micronucleated buccal epithelial cells in leukoplakia patients.
20842450 2011 Effects of selected genetic polymorphisms in xeroderma pigmentosum complementary group D on gastric cancer.
20833695 2010 The XPD subunit of TFIIH is required for transcription-associated but not DNA double-strand break-induced recombination in mammalian cells.
20832885 2010 Association of TGF-?1 and XPD polymorphisms with severe acute radiation-induced esophageal toxicity in locally advanced lung cancer patients treated with radiotherapy.
20817763 2010 Polymorphic DNA repair and metabolic genes: a multigenic study on gastric cancer.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20797633 2010 MMXD, a TFIIH-independent XPD-MMS19 protein complex involved in chromosome segregation.
20734048 2011 Phase II study of biweekly S-1 and oxaliplatin combination chemotherapy in metastatic colorectal cancer and pharmacogenetic analysis.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20723346 2009 [The Association between Polymorphisms of XPD and Susceptibility of Lung Cancer: A meta Analysis.].
20720310 2010 Association between single-nucleotide polymorphisms of selected genes involved in the response to DNA damage and risk of colon, head and neck, and breast cancers in a Polish population.
20708344 2011 Association between genetic polymorphisms in the XRCC1, XRCC3, XPD, GSTM1, GSTT1, MSH2, MLH1, MSH3, and MGMT genes and radiosensitivity in breast cancer patients.
20677654 2010 [The association of XPD G312A polymorphism with lung cancer risk: a meta-analysis].
20651612 2010 ERCC2/XPD Lys751Gln and Asp312Asn gene polymorphism and lung cancer risk: a meta-analysis involving 22 case-control studies.
20651370 2010 Insulin-like growth factors II exon 9 and E-cadherin-Pml I but not myeloperoxidase promoter-463, urokinase-ApaL I nor xeroderma pigmentosum polymorphisms are associated with higher susceptibility to leiomyoma.
20649433 2010 Oxidative stress, Helicobacter pylori, and OGG1 Ser326Cys, XPC Lys939Gln, and XPD Lys751Gln polymorphisms in a Turkish population with colorectal carcinoma.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627704 2010 ERCC2 Lys751Gln polymorphism is associated with lung cancer among Caucasians.
20627363 2011 Single nucleotide polymorphisms in MDR1 gen correlates with outcome in advanced non-small-cell lung cancer patients treated with cisplatin plus vinorelbine.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20575039 2010 XPC genetic polymorphisms correlate with the response to imatinib treatment in patients with chronic phase chronic myeloid leukemia.
20571908 2011 MUTYH Tyr165Cys, OGG1 Ser326Cys and XPD Lys751Gln polymorphisms and head neck cancer susceptibility: a case control study.
20568454 2010 [Genetic polymorphism in XPD related to risks of chronic benzene poisoning].
20564624 2010 Polymorphisms in ERCC2, MSH2, and OGG1 DNA repair genes and gallbladder cancer risk in a population of Northern India.
20559012 2009 Polyunsaturated fatty acids, DNA repair single nucleotide polymorphisms and colorectal cancer in the Singapore Chinese Health Study.
20530453 2010 Possible associations of APE1 polymorphism with susceptibility and HOGG1 polymorphism with prognosis in gastric cancer.
20530282 2010 Pharmacogenetic predictors of adverse events and response to chemotherapy in metastatic colorectal cancer: results from North American Gastrointestinal Intergroup Trial N9741.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20514470 2010 Genetic polymorphisms in the DNA repair genes XPD and XRCC1, p53 gene mutations and bladder cancer risk.
20508946 2011 Nucleotide excision repair polymorphisms and survival outcome for patients with metastatic breast cancer.
20504250 2010 Pharmacogenetic analysis in neoadjuvant chemoradiation for rectal cancer: high incidence of somatic mutations and their relation with response.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20495366 2010 Genetic polymorphisms in XRCC1 associated with radiation therapy in prostate cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20431719 2010 Pterygium and genetic polymorphisms of the DNA repair enzymes XRCC1, XPA, and XPD.
20429839 2010 Polymorphisms in DNA damage response genes and head and neck cancer risk.
20426969 2010 [Genetic susceptibility of DNA damage induced by vinyl chloride monomer exposure].
20391347 2010 DNA repair genes in endometriosis.
20391138 2010 Lifestyle, environmental, and genetic predictors of bulky DNA adducts in a study population nested within a prospective Danish cohort.
20385995 2010 Pharmacogenetic assessment of toxicity and outcome in patients with metastatic colorectal cancer treated with LV5FU2, FOLFOX, and FOLFIRI: FFCD 2000-05.
20379847 2010 Meta-analysis of two ERCC2 (XPD) polymorphisms, Asp312Asn and Lys751Gln, in breast cancer.
20379402 2010 XPD Polymorphisms and Risk of Squamous Cell Carcinoma of the Head and Neck in a Korean Sample.
20375340 2010 Polymorphisms of the DNA repair genes XPD and XRCC1 and the risk of age-related macular degeneration.
20368715 2011 Tumor response is predicted by patient genetic profile in rectal cancer patients treated with neo-adjuvant chemo-radiotherapy.
20354818 2011 The association between XPD Asp312Asn polymorphism and lung cancer risk: a meta-analysis including 16,949 subjects.
20351547 2010 Association between polymorphisms of ERCC1 and XPD and clinical response to platinum-based chemotherapy in advanced non-small cell lung cancer.
20232390 2011 Genetic variations of DNA repair genes and their prognostic significance in patients with acute myeloid leukemia.
20232359 2010 Genetic polymorphisms in DNA repair genes XPC, XPD, and XRCC4, and susceptibility to Helicobacter pylori infection-related gastric antrum adenocarcinoma in Guangxi population, China.
20229274 2010 Polymorphisms in DNA repair genes XRCC1, XRCC3 and XPD, and colorectal cancer risk: a case-control study in an Indian population.
20216541 2010 Oxaliplatin, irinotecan and capecitabine as first-line therapy in metastatic colorectal cancer (mCRC): a dose-finding study and pharmacogenomic analysis.
20204500 2010 XPD Lys751Gln polymorphism and breast cancer susceptibility: a meta-analysis involving 28,709 subjects.
20199546 2010 Interactions between ultraviolet light exposure and DNA repair gene polymorphisms may increase melanoma risk.
20183911 2010 Synergistic effects of polymorphisms in DNA repair genes and endogenous estrogen exposure on female breast cancer risk.
20170971 2010 Association of single nucleotide polymorphisms in ATM, GSTP1, SOD2, TGFB1, XPD and XRCC1 with clinical and cellular radiosensitivity.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20143185 2011 Predictive value of ERCC1 and XPD polymorphism in patients with advanced non-small cell lung cancer receiving platinum-based chemotherapy: a systematic review and meta-analysis.
20127278 2010 The association between ERCC2 Asp312Asn polymorphism and breast cancer risk: a meta-analysis involving 22,766 subjects.
20127180 2011 Impact of ERCC2 gene polymorphism on HIV-1 disease progression to AIDS among North Indian HIV patients.
20111903 2010 Associations between XPD polymorphisms and risk of breast cancer: a meta-analysis.
20104979 2009 Lack of influence of XRCC1 and XPD gene polymorphisms on outcome of platinum-based chemotherapy for advanced non small cell lung cancers.
20070155 2010 DNA repair gene X-ray repair cross-complementing group 1 and xeroderma pigmentosum group D polymorphisms and risk of prostate cancer: a study from North India.
20061190 2010 ERCC1 haplotypes modify bladder cancer risk: a case-control study.
20047592 2010 Epidermal growth factor receptor intron 1 CA dinucleotide repeat polymorphism and survival of advanced gastric cancer patients treated with cetuximab plus modified FOLFOX6.
20003463 2009 Association between polymorphisms in DNA repair genes and survival of non-smoking female patients with lung adenocarcinoma.
20003391 2009 ERCC2, ERCC1 polymorphisms and haplotypes, cooking oil fume and lung adenocarcinoma risk in Chinese non-smoking females.
19957595 2009 [Study on the relationship between hepatocellular carcinoma and the interaction between polymorphisms in DNA repair gene XPD and environmental factors].
19954624 2009 [Genetic susceptibility of single nucleotide polymorphism in MGMT to non-Hodgkin lymphoma].
19934020 2009 Both XPD alleles contribute to the phenotype of compound heterozygote xeroderma pigmentosum patients.
19922504 2010 Influence of GSTP1 I105V polymorphism on cumulative neuropathy and outcome of FOLFOX-4 treatment in Asian patients with colorectal carcinoma.
19919686 2009 XPD codon 312 and 751 polymorphisms, and AFB1 exposure, and hepatocellular carcinoma risk.
19914098 DNA repair gene polymorphisms and prostate cancer risk in South Australia--results of a pilot study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19908066 2010 The value of XPD and XRCC1 genotype polymorphisms to predict clinical outcome in metastatic colorectal carcinoma patients with irinotecan-based regimens.
19902366 2010 Genetic variation in DNA repair genes and prostate cancer risk: results from a population-based study.
19895736 2009 [Correlation of XPD gene with susceptibility to gastric cancer].
19878615 2010 Modulation of nucleotide excision repair in human lymphocytes by genetic and dietary factors.
19858398 2009 Association of molecular markers with toxicity outcomes in a randomized trial of chemotherapy for advanced colorectal cancer: the FOCUS trial.
19846926 2009 Significant association of XPD codon 312 single nucleotide polymorphism with bladder cancer susceptibility in Taiwan.
19834688 2010 Association of XPD/ERCC2 G23591A and A35931C polymorphisms with skin lesion prevalence in a multiethnic, arseniasis-hyperendemic village exposed to indoor combustion of high arsenic coal.
19826048 2009 Candidate gene association study of esophageal squamous cell carcinoma in a high-risk region in Iran.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786980 2010 Genetic polymorphisms and the efficacy and toxicity of cisplatin-based chemotherapy in ovarian cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19762325 2009 XRCC1 codon 280 and ERCC2 codon 751 polymorphisms and risk of esophageal squamous cell carcinoma in a Chinese population.
19736055 2009 Polymorphisms in the nucleotide excision repair gene ERCC2/XPD and risk of non-Hodgkin lymphoma.
19733688 Micronucleus-centromere assay and DNA repair gene polymorphism in lymphocytes of industrial radiographers.
19724896 2009 Proteins and single nucleotide polymorphisms involved in apoptosis, growth control, and DNA repair predict cisplatin sensitivity in head and neck cancer cell lines.
19707883 2010 Decreased expression and the Lys751Gln polymorphism of the XPD gene are associated with extreme longevity.
19706757 2009 Polymorphisms in DNA repair genes, smoking, and bladder cancer risk: findings from the international consortium of bladder cancer.
19706646 2009 DNA repair gene polymorphisms and risk of cutaneous melanoma: a systematic review and meta-analysis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19669592 2010 XPD Lys(751)Gln and Asp (312)Asn polymorphisms and bladder cancer risk: a meta-analysis.
19657998 2009 Association between genetic polymorphism in DNA repair genes and risk of B-cell lymphoma.
19642387 2009 [DNA repair gene xeroderma pigmentosum group D 751 polymorphism and the risk on esophageal cancer: a meta-analysis].
19638463 2009 Sequence variant discovery in DNA repair genes from radiosensitive and radiotolerant prostate brachytherapy patients.
19636001 2009 Racial differences in advanced colorectal cancer outcomes and pharmacogenetics: a subgroup analysis of a large randomized clinical trial.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19620936 2009 Cisplatin pharmacogenetics, DNA repair polymorphisms, and esophageal cancer outcomes.
19615095 2009 Statistically significant association of the single nucleotide polymorphism (SNP) rs13181 (ERCC2) with predisposition to Squamous Cell Carcinomas of the Head and Neck (SCCHN) and Breast cancer in the north Indian population.
19592152 2009 Genetic polymorphisms in DNA repair gene APE1, XRCC1 and XPD and the risk of pre-eclampsia.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19561388 2009 Common polymorphisms in the XPD and hOGG1 genes are not associated with the risk of colorectal cancer in a Polish population.
19554020 2009 Oral contraceptives: a risk factor for squamous cell carcinoma?
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19492231 2009 XPD polymorphisms, cigarette smoking, and bladder cancer risk: a meta-analysis.
19484764 2009 DNA repair polymorphisms associated with cytogenetic subgroups in B-cell chronic lymphocytic leukemia.
19470925 2009 Japanese-US common-arm analysis of paclitaxel plus carboplatin in advanced non-small-cell lung cancer: a model for assessing population-related pharmacogenomics.
19466538 2009 The polymorphism of DNA repair gene ERCC2/XPD Arg156Arg and susceptibility to breast cancer in a Chinese population.
19458053 2009 Association of XPD polymorphisms with severe toxicity in non-small cell lung cancer patients in a Chinese population.
19434073 2009 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19432884 2009 Very low prevalence of XPD K751Q polymorphism and its association with XPD expression and outcomes of FOLFOX-4 treatment in Asian patients with colorectal carcinoma.
19429237 2009 DNA repair genotype interacts with arsenic exposure to increase bladder cancer risk.
19414392 2009 Bladder cancer and polymorphisms of DNA repair genes (XRCC1, XRCC3, XPD, XPG, APE1, hOGG1).
19406934 2009 HapMap-based study of the DNA repair gene ERCC2 and lung cancer susceptibility in a Chinese population.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19367277 2009 Genetic polymorphisms in DNA repair and damage response genes and late normal tissue complications of radiotherapy for breast cancer.
19362955 2009 DNA repair gene polymorphisms predict favorable clinical outcome in advanced non-small-cell lung cancer.
19332728 2009 Pharmacogenetic analyses of a phase III trial in metastatic gastroesophageal adenocarcinoma with fluorouracil and leucovorin plus either oxaliplatin or cisplatin: a study of the arbeitsgemeinschaft internistische onkologie.
19280628 2009 Genetic polymorphisms in DNA repair genes as modulators of Hodgkin disease risk.
19274602 2009 Gene-environment interactions between DNA repair polymorphisms and exposure to the carcinogen vinyl chloride.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19257887 2009 Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups.
19242824 2010 Impact of nucleotide excision repair ERCC2 and base excision repair APEX1 genes polymorphism and its association with recurrence after adjuvant BCG immunotherapy in bladder cancer patients of North India.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19203783 2009 Genetic polymorphisms affecting clinical outcomes in epithelial ovarian cancer patients treated with taxanes and platinum compounds: a Korean population-based study.
19177501 2009 Chromosomal aberrations in railroad transit workers: effect of genetic polymorphisms.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19162321 2009 Polymorphisms of xenobiotic metabolizing enzymes and DNA repair genes and outcome in childhood acute lymphoblastic leukemia.
19124519 2009 DNA repair gene variants associated with benign breast disease in high cancer risk women.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19109787 2009 Polymorphisms of DNA repair genes: ADPRT, XRCC1, and XPD and cancer risk in genetic epidemiology.
19106100 2009 MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.
19101034 2009 DNA repair gene XPD and XRCC1 polymorphisms and the risk of childhood acute lymphoblastic leukemia.
19096231 2008 Susceptibility of XRCC3, XPD, and XPG genetic variants to cervical carcinoma.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19074750 2009 Pharmacogenetic analyses of hematotoxicity in advanced gastric cancer patients receiving biweekly fluorouracil, leucovorin, oxaliplatin and docetaxel (FLOT): a translational study of the Arbeitsgemeinschaft Internistische Onkologie (AIO).
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19055600 2009 Analysis of ERCC2/XPD functional polymorphisms in systemic lupus erythematosus.
19052983 2008 Case-only study of interactions between DNA repair genes (hMLH1, APEX1, MGMT, XRCC1 and XPD) and low-frequency electromagnetic fields in childhood acute leukemia.
19051060 2009 Contribution of XPD (Lys751Gln) and XRCC1 (Arg399Gln) polymorphisms in familial and sporadic breast cancer predisposition and survival: an Indian report.
19041121 2009 Influence of XPD and APE1 DNA repair gene polymorphism on bladder cancer susceptibility in north India.
19029193 2009 Red meat and poultry intake, polymorphisms in the nucleotide excision repair and mismatch repair pathways and colorectal cancer risk.
19027952 2009 Polymorphisms of detoxification and DNA repair enzymes in myelodyplastic syndromes.
19027756 2009 Micronuclei and chromosomal aberrations, important markers of ageing: possible association with XPC and XPD polymorphisms.
18990748 2008 International Lung Cancer Consortium: pooled analysis of sequence variants in DNA repair and cell cycle pathways.
18977234 2008 Association between DNA damage, DNA repair genes variability and clinical characteristics in breast cancer patients.
18946634 2009 Implications of XRCC1, XPD and APE1 gene polymorphism in North Indian population: a comparative approach in different ethnic groups worldwide.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18838045 2009 Inter-individual variation in nucleotide excision repair in young adults: effects of age, adiposity, micronutrient supplementation and genotype.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18825991 [The evaluation of association between polymorphisms of DNA excision repair enzyme genes and risk of malignant tumors development in Siberian Group of Chemical Enterprises workers].
18817897 2008 Comparative study of nucleotide excision repair defects between XPD-mutated fibroblasts derived from trichothiodystrophy and xeroderma pigmentosum patients.
18797464 2008 Pharmacogenetic prediction of clinical outcome in advanced colorectal cancer patients receiving oxaliplatin/5-fluorouracil as first-line chemotherapy.
18778871 2009 Stratification for smoking in case-cohort studies of genetic polymorphisms and lung cancer.
18767034 2008 Nucleotide excision repair polymorphisms may modify ionizing radiation-related breast cancer risk in US radiologic technologists.
18752184 2008 The investigation of DNA repair polymorphisms with histopathological characteristics and hormone receptors in a group of Brazilian women with breast cancer.
18711149 2008 Case-control analysis of nucleotide excision repair pathway and the risk of renal cell carcinoma.
18709642 2008 Nucleotide excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African Americans.
18701435 2008 Polygenic model of DNA repair genetic polymorphisms in human breast cancer risk.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18641418 2008 DNA repair polymorphisms and the risk of stomach adenocarcinoma and severe chronic gastritis in the EPIC-EURGAST study.
18637129 2009 Strict sun protection results in minimal skin changes in a patient with xeroderma pigmentosum and a novel c.2009delG mutation in XPD (ERCC2).
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18635523 2008 Genotypes and haplotypes of ERCC1 and ERCC2/XPD genes predict levels of benzo[a]pyrene diol epoxide-induced DNA adducts in cultured primary lymphocytes from healthy individuals: a genotype-phenotype correlation analysis.
18630471 DNA repair gene ERCC2, XPC, XRCC1, XRCC3 polymorphisms and associations with bladder cancer risk in a French cohort.
18627000 2008 Influence of DNA repair gene polymorphisms on the initial repair of MMS-induced DNA damage in human lymphocytes as measured by the alkaline comet assay.
18616887 2008 ERCC1 and ERCC2 polymorphisms and risk of idiopathic azoospermia in a Chinese population.
18603015 2008 Polymorphisms in metabolic GSTP1 and DNA-repair XRCC1 genes with an increased risk of DNA damage in pesticide-exposed fruit growers.
18578568 2008 Crystal structure of the FeS cluster-containing nucleotide excision repair helicase XPD.
18575735 2008 The Gln/Gln genotype of XPD codon 751 as a genetic marker for melanoma risk and Lys/Gln as an important predictor for melanoma progression: a case control study in the Swedish population.
18569591 2008 Head and neck squamous-cell cancer and its association with polymorphic enzymes of xenobiotic metabolism and repair.
18559563 2008 Detecting pathway-based gene-gene and gene-environment interactions in pancreatic cancer.
18544627 2008 Polymorphisms in DNA repair genes, smoking, and pancreatic adenocarcinoma risk.
18534129 Genetic polymorphisms in the DNA repair enzyme ERCC2 and breast tumour risk in a Chinese population.
18509181 2008 Predictive biomarkers of chemotherapy efficacy in colorectal cancer: results from the UK MRC FOCUS trial.
18505590 2008 Modified FOLFOX-6 chemotherapy in advanced gastric cancer: Results of phase II study and comprehensive analysis of polymorphisms as a predictive and prognostic marker.
18495522 2008 Cytogenetic effects induced by Prestige oil on human populations: the role of polymorphisms in genes involved in metabolism and DNA repair.
18494946 2008 mRNA expression of RRM1, ERCC1 and ERCC2 is not associated with chemosensitivity to cisplatin, carboplatin and gemcitabine in human lung cancer cell lines.
18483312 2008 Ethnic disparities in Americans of European descent versus Americans of African descent related to polymorphic ERCC1, ERCC2, XRCC1, and PARP1.
18478337 2008 Polymorphisms of the NER pathway genes, ERCC1 and XPD are associated with esophageal adenocarcinoma risk.
18470933 2008 Persistence of repair proteins at unrepaired DNA damage distinguishes diseases with ERCC2 (XPD) mutations: cancer-prone xeroderma pigmentosum vs. non-cancer-prone trichothiodystrophy.
18459458 2007 XPD Lys751Gln polymorphism analysis in women with sporadic breast cancer.
18454848 2008 DNA repair gene ERCC2 polymorphisms and associations with breast and ovarian cancer risk.
18448328 2008 Pharmacogenetic approach for capecitabine or 5-fluorouracil selection to be combined with oxaliplatin as first-line chemotherapy in advanced colorectal cancer.
18442012 2007 Relationship between polymorphisms of nucleotide excision repair genes and oral cancer risk in Taiwan: evidence for modification of smoking habit.
18420361 2008 Polymorphisms and haplotypes of DNA repair and xenobiotic metabolism genes and risk of DNA damage in Chinese vinyl chloride monomer (VCM)-exposed workers.
18415712 2008 Polymorphisms of the XRCC1 and XPD genes and breast cancer risk: a case-control study.
18415014 2009 Genetic contribution to all cancers: the first demonstration using the model of breast cancers from Poland stratified by age at diagnosis and tumour pathology.
18394656 2008 Chromosomal aberrations in tire plant workers and interaction with polymorphisms of biotransformation and DNA repair genes.
18386788 2008 Polymorphisms in MGMT and DNA repair genes and the risk of esophageal adenocarcinoma.
18365755 2008 Bladder cancer, GSTs, NAT1, NAT2, SULT1A1, XRCC1, XRCC3, XPD genetic polymorphisms and coffee consumption: a case-control study.
18358500 2008 Haplotypes of nine single nucleotide polymorphisms on chromosome 19q13.2-3 associated with susceptibility of lung cancer in a Chinese population.
18349297 2008 No association between hOGG1, XRCC1, and XPD polymorphisms and risk of reflux esophagitis, Barrett's esophagus, or esophageal adenocarcinoma: results from the factors influencing the Barrett's adenocarcinoma relationship case-control study.
18349268 2008 DNA repair gene XPD polymorphisms and cancer risk: a meta-analysis based on 56 case-control studies.
18347182 2008 Correlation of CDA, ERCC1, and XPD polymorphisms with response and survival in gemcitabine/cisplatin-treated advanced non-small cell lung cancer patients.
18335219 2008 Cisplatin plus weekly CPT-11/docetaxel in advanced esophagogastric cancer: a phase I study with pharmacogenetic assessment of XPD, XRCC3 and UGT1A1 polymorphisms.
18320070 2008 DNA repair gene polymorphisms may be associated with prognosis of upper urinary tract transitional cell carcinoma.
18315909 2008 [Association of gene polymorphisms in the DNA repair gene XPD with risk of non-Hodgkin's lymphoma].
18267032 2008 ERCC2 2251A>C genetic polymorphism was highly correlated with early relapse in high-risk stage II and stage III colorectal cancer patients: a preliminary study.
18246963 2007 Early-onset of sporadic basal-cell carcinoma: germline mutations in the TP53, PTCH, and XPD genes.
18230301 2007 [Association of genetic polymorphism of XPD with chromosomal damage in workers exposed to radiation].
18204222 2007 Single nucleotide polymorphisms in nucleotide excision repair genes XPA, XPD, XPG and ERCC1 in advanced colorectal cancer patients treated with first-line oxaliplatin/fluoropyrimidine.
18196582 2008 Polymorphisms in XPC and ERCC2 genes, smoking and breast cancer risk.
18177646 2008 X-ray repair cross-complementing group 4 (XRCC4) promoter -1394( *)T-related genotype, but not XRCC4 codon 247/intron 3 or xeroderma pigmentosum group D codon 312, 751/promoter -114, polymorphisms are correlated with higher susceptibility to myoma.
18095557 2007 [Association between genetic polymorphisms of DNA repair genes XRCC1, XPD, XRCC3 and the capacity of DNA repair induce by benzene].
18085999 2007 Determination of ERCC2 Lys751Gln and GSTP1 Ile105Val gene polymorphisms in colorectal cancer patients: relationships with treatment outcome.
18081788 Protein expression levels of excision repair cross-complementation group 1 and xeroderma pigmentosum D correlate with response to platinum-based chemotherapy in the patients with advanced epithelial ovarian cancer.
18075460 2007 Single nucleotide polymorphisms of the DNA repair gene XPD/ERCC2 alter mRNA expression.
18044339 2007 [Polymorphism Lys751Gln of XPD gene and breast cancer risk in women].
18043991 2007 DNA repair gene XRCC1 and XPD polymorphisms and their association with coronary artery disease risks and micronucleus frequency.
18035379 2008 Influence of GSTM1 null and low repair XPC PAT+ on anti-B[a]PDE-DNA adduct in mononuclear white blood cells of subjects low exposed to PAHs through smoking and diet.
18006925 2007 DNA repair single-nucleotide polymorphisms in colorectal cancer and their role as modifiers of the effect of cigarette smoking and alcohol in the Singapore Chinese Health Study.
17953974 2008 Inherited susceptibility to bleomycin-induced micronuclei: correlating polymorphisms in GSTT1, GSTM1 and DNA repair genes with mutagen sensitivity.
17952468 2008 Prognostic importance of DNA repair gene polymorphisms of XRCC1 Arg399Gln and XPD Lys751Gln in lung cancer patients from India.
17932351 2007 Polymorphisms in nucleotide excision repair genes, polycyclic aromatic hydrocarbon-DNA adducts, and breast cancer risk.
17925548 2007 Pharmacogenetic assessment of toxicity and outcome after platinum plus taxane chemotherapy in ovarian cancer: the Scottish Randomised Trial in Ovarian Cancer.
17913280 2008 Polymorphisms in nucleotide excision repair genes, smoking and intake of fruit and vegetables in relation to lung cancer.
17912469 2007 DNA repair gene XRCC1 and XPD polymorphisms and the risk of idiopathic azoospermia in a Chinese population.
17898541 2008 DNA repair polymorphisms modify bladder cancer risk: a multi-factor analytic strategy.
17896209 2008 PAH-DNA adducts in a Chinese population: relationship to PAH exposure, smoking and polymorphisms of metabolic and DNA repair genes.
17825393 2007 Moving toward individualized therapy based on NER polymorphisms that predict platinum sensitivity in ovarian cancer patients.
17728339 2007 High-order interactions among genetic polymorphisms in nucleotide excision repair pathway genes and smoking in modulating bladder cancer risk.
17712032 2007 The association of DNA repair gene polymorphisms with the development and progression of renal cell carcinoma.
17705814 2007 Polymorphisms in XPC, XPD, XRCC1, and XRCC3 DNA repair genes and lung cancer risk in a population of northern Spain.
17696747 XRCC1 and XPD gene polymorphisms in a South Indian population.
17695467 Association of XPD polymorphisms with prostate cancer in Taiwanese patients.
17693188 2007 Polymorphisms of the DNA gene XPD and risk of bladder cancer in a Southeastern Chinese population.
17687452 2007 Polymorphisms in nucleotide excision repair genes, arsenic exposure, and non-melanoma skin cancer in New Hampshire.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17637462 2007 Polymorphisms of DNA repair genes XPD and XRCC1 and risk of cataract development.
17630853 2007 Genetic polymorphisms of the DNA repair gene and risk of nasopharyngeal carcinoma.
17630376 2007 A prospective study of polymorphisms of DNA repair genes XRCC1, XPD23 and APE/ref-1 and risk of stroke in Linxian, China.
17627014 2007 Mammographic density and candidate gene variants: a twins and sisters study.
17617021 2007 Polymorphisms in genes involved in DNA repair and metabolism of xenobiotics in individual susceptibility to sporadic diffuse gastric cancer.
17614221 2007 Genetic susceptibility of newborn daughters to oxidative stress.
17605237 2007 [Analysis for the association between genetic polymorphisms of XRCC1, XPD, XRCC3, CCND1 and the latency of the occupational chronic benzene poisoning].
17604576 2007 The DNA repair gene XPD/ERCC2 polymorphisms Arg156Arg (exon 6) and Lys751Gln (exon 23) are closely associated.
17593927 2007 Polymorphism of XRCC1 predicts overall survival of gastric cancer patients receiving oxaliplatin-based chemotherapy in Chinese population.
17575242 2007 Nucleotide excision repair pathway genes and oral premalignant lesions.
17556064 2007 XRCC1 codon 399 and ERCC2 codon 751 polymorphism, smoking, and drinking and risk of esophageal squamous cell carcinoma in a North Indian population.
17549067 2008 Pharmacogenetic profiling in patients with advanced colorectal cancer treated with first-line FOLFIRI chemotherapy.
17548684 2007 Path analysis of biomarkers of exposure and early biological effects among coke-oven workers exposed to polycyclic aromatic hydrocarbons.
17531525 2007 Polymorphisms in base-excision repair and nucleotide-excision repair genes in relation to lung cancer risk.
17504986 2007 Prospective assessment of XPD Lys751Gln and XRCC1 Arg399Gln single nucleotide polymorphisms in lung cancer.
17498557 2007 A haplotype encompassing the variant allele of DNA repair gene polymorphism ERCC2/XPD Lys751Gln but not the variant allele of Asp312Asn is associated with risk of lung cancer in a northeastern Chinese population.
17479411 2007 Reduced expression of human DNA repair genes in esophageal squamous-cell carcinoma in china.
17470448 2007 Polymorphisms in XPD (Asp312Asn and Lys751Gln) genes, sunburn and arsenic-related skin lesions.
17466626 2007 Distinct roles for the XPB/p52 and XPD/p44 subcomplexes of TFIIH in damaged DNA opening during nucleotide excision repair.
17438703 2007 Polymorphisms in XPD, XPC and the risk of death in patients with urinary bladder neoplasms.
17438655 Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers.
17412371 2007 PAH-DNA adducts in environmentally exposed population in relation to metabolic and DNA repair gene polymorphisms.
17410042 2007 A pharmacogenomic study of docetaxel and gemcitabine for the initial treatment of advanced non-small cell lung cancer.
17409981 2006 A phase II study of irinotecan and carboplatin in advanced non-small cell lung cancer with pharmacogenomic analysis: final report.
17403617 2007 Common XPD (ERCC2) polymorphisms have no measurable effect on nucleotide excision repair and basal transcription.
17401013 2007 Pharmacogenetic profiling in patients with advanced colorectal cancer treated with first-line FOLFOX-4 chemotherapy.
17374967 2006 Association between DNA repair gene polymorphisms and p53 alterations in Japanese patients with muscle-invasive bladder cancer.
17363013 2007 XPA A23G, XPC Lys939Gln, XPD Lys751Gln and XPD Asp312Asn polymorphisms, interactions with smoking, alcohol and dietary factors, and risk of colorectal cancer.
17313739 2006 [Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers].
17299578 2007 Genetic polymorphisms in the nucleotide excision repair pathway and lung cancer risk: a meta-analysis.
17290401 2007 Polymorphisms at XPD and XRCC1 DNA repair loci and increased risk of oral leukoplakia and cancer among NAT2 slow acetylators.
17264068 2007 XRCC1 and XPD polymorphisms and esophageal adenocarcinoma risk.
17242676 2007 Polymorphisms of DNA repair genes XRCC1 and XPD and risk of primary open angle glaucoma (POAG).
17210993 2007 DNA repair gene polymorphisms and genetic predisposition to cutaneous melanoma.
17197435 2007 Polymorphisms in DNA repair genes and therapeutic outcomes of AML patients from SWOG clinical trials.
17191090 2007 Association between polymorphisms of biotransformation and DNA-repair genes and risk of colorectal cancer in Taiwan.
17164380 2006 Polymorphisms in the DNA repair genes XPC, XPD, and XPG and risk of cutaneous melanoma: a case-control analysis.
17164360 2006 XRCC1, XRCC3, and XPD polymorphisms as modifiers of the effect of smoking and alcohol on colorectal adenoma risk.
17158087 2007 Polymorphisms of phase II xenobiotic-metabolizing and DNA repair genes and in vitro N-ethyl-N-nitrosourea-induced O6-ethylguanine levels in human lymphocytes.
17151930 2007 Single nucleotide polymorphisms and expression of ERCC1 and ERCC2 vis-à-vis chemotherapy drug cytotoxicity in human glioma.
17131345 2007 Polymorphisms in the genes ERCC2, XRCC3 and CD3EAP influence treatment outcome in multiple myeloma patients undergoing autologous bone marrow transplantation.
17111423 2006 Polymorphisms in the thymidylate synthase promoter and the DNA repair genes XRCC1 and XPD in a Brazilian population.
17088560 2006 DNA nucleotide excision repair-dependent signaling to checkpoint activation.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17063276 2007 DNA repair polymorphisms might contribute differentially on familial and sporadic breast cancer susceptibility: a study on a Portuguese population.
17050553 2007 Polymorphism in the ERCC2 codon 751 is associated with arsenic-induced premalignant hyperkeratosis and significant chromosome aberrations.
17023576 2007 A common genetic variant in XPD associates with risk of 5q- and 7q-deleted acute myeloid leukemia.
17018785 2006 Commonly studied single-nucleotide polymorphisms and breast cancer: results from the Breast Cancer Association Consortium.
17009404 2006 Xeroderma pigmentosum group D 751 polymorphism as a predictive factor in resected gastric cancer treated with chemo-radiotherapy.
16997330 2006 Influence of DNA repair gene polymorphisms of hOGG1, XRCC1, XRCC3, ERCC2 and the folate metabolism gene MTHFR on chromosomal aberration frequencies.
16985021 2006 Polymorphisms in nucleotide excision repair genes and DNA repair capacity phenotype in sisters discordant for breast cancer.
16896002 2006 DNA-repair gene polymorphisms predict favorable clinical outcome among patients with advanced squamous cell carcinoma of the head and neck treated with cisplatin-based induction chemotherapy.
16889696 2006 [Association between polymorphisms of XPD gene and susceptibility to chronic benzene poisoning].
16884686 2006 Identification and Herc5-mediated ISGylation of novel target proteins.
16880786 2006 Single nucleotide polymorphisms in DNA repair genes might be prognostic factors in muscle-invasive bladder cancer patients treated with chemoradiotherapy.
16875933 2006 Polymorphism of the DNA repair gene ERCC2 Lys751Gln and risk of lung cancer in a northeastern Chinese population.
16875718 2006 XRCC1 R399Q polymorphism is associated with response to platinum-based neoadjuvant chemotherapy in bulky cervical cancer.
16875604 2006 [XRCC1 and XPD genetic polymorphisms predict clinical responses to platinum-based chemotherapy in advanced non-small cell lung cancer].
16865671 2006 Polymorphisms in DNA repair genes XPD and XRCC1 and p53 mutations in lung carcinomas of never-smokers.
16835333 2006 Polymorphisms in the two helicases ERCC2/XPD and ERCC3/XPB of the transcription factor IIH complex and risk of lung cancer: a case-control analysis in a Chinese population.
16824555 2006 Influence of DNA repair polymorphisms on biomarkers of genotoxic damage in peripheral lymphocytes of healthy subjects.
16823510 2007 Breast cancer risk is not associated with polymorphic forms of xeroderma pigmentosum genes in a cohort of women from Washington County, Maryland.
16806697 2006 Polymorphisms in the DNA repair genes XPD (ERCC2) and XPF (ERCC4) are not associated with sporadic late-onset Alzheimer's disease.
16738949 2006 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma among women in Connecticut.
16710452 2006 Effect of DNA repair protein Rad18 on viral infection.
16707649 2006 XRCC3 and XPD/ERCC2 single nucleotide polymorphisms and the risk of cancer: a HuGE review.
16685590 2006 XPD common variants and their association with melanoma and breast cancer risk.
16677755 2007 Importance of xeroderma pigmentosum group D polymorphisms in susceptibility to ovarian cancer.
16672066 2006 SNP-SNP interactions in breast cancer susceptibility.
16652373 2006 DNA repair gene polymorphisms and probability of p53 mutation in bladder cancer.
16649224 2006 Xeroderma pigmentosum group D haplotype predicts for response, survival, and toxicity after platinum-based chemotherapy in advanced nonsmall cell lung cancer.
16646069 2006 Genetic polymorphisms of the XPG and XPD nucleotide excision repair genes in sarcoma patients.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16622263 2006 Pharmacogenetic profiling and clinical outcome of patients with advanced gastric cancer treated with palliative chemotherapy.
16609022 2006 Polymorphisms in genes of nucleotide and base excision repair: risk and prognosis of colorectal cancer.
16571649 2006 The XPD 751Gln allele is associated with an increased risk for esophageal adenocarcinoma: a population-based case-control study in Sweden.
16564556 2006 Polymorphisms in DNA repair genes as risk factors for asbestos-related malignant mesothelioma in a general population study.
16542436 2006 Polymorphisms of the XRCC1, XRCC3 and XPD genes and risk of colorectal adenoma and carcinoma, in a Norwegian cohort: a case control study.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16507781 2006 Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16492913 2006 Variation in DNA repair genes ERCC2, XRCC1, and XRCC3 and risk of follicular lymphoma.
16475125 2005 DNA repair gene polymorphisms and susceptibility to familial breast cancer in a group of patients from Campinas, Brazil.
16465622 2006 Bladder cancer predisposition: a multigenic approach to DNA-repair and cell-cycle-control genes.
16458430 2007 The XPD Asp312Asn and Lys751Gln polymorphisms, corresponding haplotype, and pancreatic cancer risk.
16435384 2007 Genetic polymorphisms and haplotypes of DNA repair genes in childhood acute lymphoblastic leukemia.
16407418 2006 Polymorphisms in DNA repair genes modulate survival in cisplatin/gemcitabine-treated non-small-cell lung cancer patients.
16399771 2006 Polymorphisms in nucleotide excision repair genes, smoking and breast cancer in African Americans and whites: a population-based case-control study.
16373199 2006 Polymorphism in DNA repair genes and oral squamous cell carcinoma in Thailand.
16369171 2005 DNA repair gene polymorphisms and risk of second primary neoplasms and mortality in oral cancer patients.
16351803 2005 [Correlation of genetic polymorphisms in nucleotide excision repair system to sensitivity of advanced non-small cell lung cancer patients to platinum-based chemotherapy].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16343742 2006 Influence of polymorphism in DNA repair and defence genes on p53 mutations in bladder tumours.
16341674 2005 Transcriptome analysis of human gastric cancer.
16324877 2006 Single nucleotide polymorphisms of DNA repair genes XRCC1 and XPD and its molecular mapping in Indian oral cancer.
16319991 2006 Polymorphisms of the DNA repair genes XPD (Lys751Gln) and XRCC1 (Arg399Gln and Arg194Trp): relationship to breast cancer risk and familial predisposition to breast cancer.
16311243 2006 Concordance of multiple analytical approaches demonstrates a complex relationship between DNA repair gene SNPs, smoking and bladder cancer susceptibility.
16308313 2006 DNA repair polymorphisms and cancer risk in non-smokers in a cohort study.
16284380 2005 Polymorphisms/haplotypes in DNA repair genes and smoking: a bladder cancer case-control study.
16284373 2005 Interindividual variation in nucleotide excision repair genes and risk of endometrial cancer.
16284370 2005 DNA repair polymorphisms and risk of colorectal adenomatous or hyperplastic polyps.
16280050 2005 XRCC1 and XPD genetic polymorphisms, smoking and breast cancer risk in a Finnish case-control study.
16258177 2006 Polymorphisms in nucleotide excision repair genes and risk of multiple primary melanoma: the Genes Environment and Melanoma Study.
16217922 2005 Polymorphisms of DNA repair gene XPD and DNA damage of workers exposed to vinylchloride monomer.
16214924 2005 Association of polymorphisms in ERCC2 gene with non-familial thyroid cancer risk.
16212814 2005 ERCC1 and ERCC2 polymorphisms and adult glioma.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16172101 2005 Association of cytokine and DNA repair gene polymorphisms with hepatitis B-related hepatocellular carcinoma.
16150943 2006 XPD Lys751Gln polymorphism in the etiology and outcome of childhood acute myeloid leukemia: a Children's Oncology Group report.
16061005 2005 [Polymorphisms in nucleotide excision repair genes XPC and XPD and clinical responses to platinum-based chemotherapy in advanced non-small cell lung cancer].
16054878 2005 Polymorphisms in the human XPD (ERCC2) gene, DNA repair capacity and cancer susceptibility: an appraisal.
16043197 2006 Genetic polymorphisms and possible gene-gene interactions in metabolic and DNA repair genes: effects on DNA damage.
16038584 2005 Influence of polymorphisms in DNA repair genes XPD, XRCC1 and MGMT on DNA damage induced by gamma radiation and its repair in lymphocytes in vitro.
16037119 2005 Genetic polymorphisms and the effect of cigarette smoking in the comet assay.
16030124 2005 Common polymorphisms in ERCC2 (Xeroderma pigmentosum D) are not associated with breast cancer risk.
16030112 2005 Selected genetic polymorphisms in MGMT, XRCC1, XPD, and XRCC3 and risk of head and neck cancer: a pooled analysis.
16002061 2005 Single nucleotide polymorphisms for DNA repair genes in breast cancer patients.
16000577 2005 Association between polymorphisms in the DNA repair genes, XRCC1, APE1, and XPD and acute side effects of radiotherapy in breast cancer patients.
15992842 2005 DNA repair and cyclin D1 polymorphisms and styrene-induced genotoxicity and immunotoxicity.
15971256 2005 Influence of DNA repair gene polymorphisms on the yield of chromosomal aberrations.
15941969 2005 Genetic variation in XPD, sun exposure, and risk of skin cancer.
15936590 2005 Effect of polymorphisms in XPD, RAI, ASE-1 and ERCC1 on the risk of basal cell carcinoma among Caucasians after age 50.
15914277 2005 The impact of genetic factors on the incidence of multiple primary tumors (MPT) of the head and neck.
15914210 2005 Basal cell carcinoma and variants in genes coding for immune response, DNA repair, folate and iron metabolism.
15896456 2005 The DNA repair gene ERCC2/XPD polymorphism Arg 156Arg (A22541C) and risk of lung cancer in a Chinese population.
15887293 2005 Polymorphisms in DNA repair genes as risk factors for spina bifida and orofacial clefts.
15886521 2005 Obesity and genetic polymorphism of ERCC2 and ERCC4 as modifiers of risk of breast cancer.
15885892 2005 Polymorphisms in RAI and in genes of nucleotide and base excision repair are not associated with risk of testicular cancer.
15878910 2005 Polymorphisms in DNA repair genes in the molecular pathogenesis of esophageal (Barrett) adenocarcinoma.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15837542 2005 Combinations of polymorphisms in XPD, XPC and XPA in relation to risk of lung cancer.
15834925 2005 Polymorphisms in GLTSCR1 and ERCC2 are associated with the development of oligodendrogliomas.
15824172 2005 Genotyping of patients with sporadic and radiation-associated meningiomas.
15824159 2005 Polymorphisms in XPD exons 10 and 23 and bladder cancer risk.
15802298 2005 Selected DNA repair polymorphisms and gastric cancer in Poland.
15776433 2005 Polymorphism in the nuclear excision repair gene ERCC2/XPD: association between an exon 6-exon 10 haplotype and susceptibility to cutaneous basal cell carcinoma.
15764301 Associations between XRCC1 and ERCC2 polymorphisms and DNA damage in peripheral blood lymphocyte among coke oven workers.
15754315 2005 Association of polymorphisms in the cyclin D1 and XPD genes and susceptibility to cancers of the upper aero-digestive tract.
15746160 2005 Constitutional short telomeres are strong genetic susceptibility markers for bladder cancer.
15746040 2005 Nucleotide excision repair gene polymorphisms and recurrence after treatment for superficial bladder cancer.
15729710 2005 SNP genotyping using microsphere-linked PNA and flow cytometric detection.
15709194 2005 Impact of gene polymorphisms on clinical outcome for stage IV melanoma patients treated with biochemotherapy: an exploratory study.
15679883 2005 Polymorphisms of the XRCC1, XRCC3, & XPD genes, and colorectal cancer risk: a case-control study in Taiwan.
15635413 2005 Nucleolar proteome dynamics.
15615908 2005 ERCC2 /XPD gene polymorphisms and lung cancer: a HuGE review.
15598761 2004 ERCC2 genotypes and a corresponding haplotype are linked with breast cancer risk in a German population.
15598760 2004 Polymorphism in the DNA repair gene XPD, polycyclic aromatic hydrocarbon-DNA adducts, cigarette smoking, and breast cancer risk.
15534626 2005 Interethnic variability of ERCC2 polymorphisms.
15523694 2005 Genotype phenotype correlations in Israeli colorectal cancer patients.
15494306 2004 Selective regulation of vitamin D receptor-responsive genes by TFIIH.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471894 2005 Reduced nucleotide excision repair and GSTM1-null genotypes influence anti-B[a]PDE-DNA adduct levels in mononuclear white blood cells of highly PAH-exposed coke oven workers.
15381366 2004 Polymorphisms in the DNA repair gene XPD and susceptibility to esophageal squamous cell carcinoma.
15339847 2004 Genetic variation in XPD predicts treatment outcome and risk of acute myeloid leukemia following chemotherapy.
15333465 2004 Specific combinations of DNA repair gene variants and increased risk for non-small cell lung cancer.
15298945 2004 XPD polymorphism and risk of subsequent cancer in individuals with nonmelanoma skin cancer.
15277258 2004 Single nucleotide polymorphisms and outcome in docetaxel-cisplatin-treated advanced non-small-cell lung cancer.
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
15213713 2004 A multivariate analysis of genomic polymorphisms: prediction of clinical outcome to 5-FU/oxaliplatin combination chemotherapy in refractory colorectal cancer.
15199549 2004 Polymorphisms in DNA repair genes, chromosome aberrations, and lung cancer.
15199548 2004 Effect of XPD/ERCC2 polymorphisms on chromosome aberration frequencies in smokers and on sensitivity to the mutagenic tobacco-specific nitrosamine NNK.
15173214 2004 XPD and XRCC1 genetic polymorphisms are prognostic factors in advanced non-small-cell lung cancer patients treated with platinum chemotherapy.
15159312 2004 High-throughput association testing on DNA pools to identify genetic variants that confer susceptibility to acute myeloid leukemia.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15140544 2004 Association between polymorphisms of ERCC1 and XPD and survival in non-small-cell lung cancer patients treated with cisplatin combination chemotherapy.
15090466 2004 Reduced DNA repair of benzo[a]pyrene diol epoxide-induced adducts and common XPD polymorphisms in breast cancer patients.
14735199 2004 XPD gene polymorphism and host characteristics in the association with cutaneous malignant melanoma risk.
14729591 2004 Genetic polymorphisms in DNA repair genes and possible links with DNA repair rates, chromosomal aberrations and single-strand breaks in DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688016 2004 Polymorphisms in DNA repair and metabolic genes in bladder cancer.
14668933 2003 Influence of genetic markers on survival in non-small cell lung cancer.
14652287 2003 Polymorphisms of the DNA repair genes XRCC1, XRCC3, XPD, interaction with environmental exposures, and bladder cancer risk in a case-control study in northern Italy.
14625810 2003 Variable continental distribution of polymorphisms in the coding regions of DNA-repair genes.
14624713 2003 Assessment of nucleotide excision repair XPD polymorphisms in the peripheral blood of gemcitabine/cisplatin-treated advanced non-small-cell lung cancer patients.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
14568296 2003 Effects of ALDH2 gene polymorphisms and alcohol-drinking behavior on micronuclei frequency in non-smokers.
12883749 Genetic polymorphisms and susceptibility to esophageal cancer among Chinese population (review).
12865926 2003 Lack of involvement of nucleotide excision repair gene polymorphisms in colorectal cancer.
12844488 2003 Association of the DNA repair gene XPD Asp312Asn polymorphism with p53 gene mutations in tobacco-related non-small cell lung cancer.
12820975 2003 Basal transcription defect discriminates between xeroderma pigmentosum and trichothiodystrophy in XPD patients.
12749816 2003 DNA repair gene XPD and susceptibility to arsenic-induced hyperkeratosis.
12740916 2003 Sequence variations in the DNA repair gene XPD and risk of lung cancer in a Chinese population.
12692111 2003 Polymorphisms in the DNA repair genes XRCC1 and ERCC2, smoking, and lung cancer risk.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12645871 2003 Twelve single nucleotide polymorphisms on chromosome 19q13.2-13.3: linkage disequilibria and associations with basal cell carcinoma in Danish psoriatic patients.
12579497 2003 [Association of genetic polymorphisms in the DNA repair gene XPD with risk of lung and esophageal cancer in a Chinese population in Beijing].
12552590 2003 Influence of common XPD and XRCC1 variant alleles on p53 mutations in lung tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458209 2003 Structural and functional characterization of the human DNA repair helicase XPD by comparative molecular modeling and site-directed mutagenesis of the bacterial repair protein UvrB.
12451985 2002 Nucleotide excision repair protein levels vis-à-vis anticancer drug resistance in 60 human tumor cell lines.
12435843 2002 ERCC2/XPD gene polymorphisms and cancer risk.
12399122 2002 Polymorphisms of the DNA repair gene XPD and risk of lung cancer in a Chinese population.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12393447 2002 The genotype distribution of the XRCC1 gene indicates a role for base excision repair in the development of therapy-related acute myeloblastic leukemia.
12376500 2002 XPD codon 751 polymorphism, metabolism genes, smoking, and bladder cancer risk.
12372413 2002 Association of human RAD52 protein with transcription factors.
12359753 2002 Regulation of cisplatin resistance and homologous recombinational repair by the TFIIH subunit XPD.
12243508 2002 Polymorphisms in the DNA repair enzyme XPD are associated with increased levels of PAH-DNA adducts in a case-control study of breast cancer.
12220217 2002 DNA repair gene ERCC1 and ERCC2/XPD polymorphisms and risk of squamous cell carcinoma of the head and neck.
12151350 2002 DNA repair gene XRCC1 and XPD polymorphisms and risk of lung cancer in a Chinese population.
12124811 2002 Polymorphisms of DNA repair genes XRCC1 and XPD and their associations with risk of esophageal squamous cell carcinoma in a Chinese population.
12115580 2002 Effect of DNA repair gene polymorphisms on BPDE-DNA adducts in human lymphocytes.
12110342 2002 XPD/ERCC2 EXON 8 Polymorphisms: rarity and lack of significance in risk of squamous cell carcinoma of the head and neck.
11891028 2002 Lys751Gln polymorphism in the DNA repair gene XPD and risk of primary lung cancer.
11888908 2002 Gene-environment interaction for the ERCC2 polymorphisms and cumulative cigarette smoking exposure in lung cancer.
11872635 2002 Modulation of repair of ultraviolet damage in the host-cell reactivation assay by polymorphic XPC and XPD/ERCC2 genotypes.
11709541 2001 Two individuals with features of both xeroderma pigmentosum and trichothiodystrophy highlight the complexity of the clinical outcomes of mutations in the XPD gene.
11532866 2001 XRCC1, XRCC3, XPD gene polymorphisms, smoking and (32)P-DNA adducts in a sample of healthy subjects.
11470747 2001 XPD exon 10 and 23 polymorphisms and DNA repair in human skin in situ.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
11443545 2001 Cerebro-oculo-facio-skeletal syndrome with a nucleotide excision-repair defect and a mutated XPD gene, with prenatal diagnosis in a triplet pregnancy.
11375896 2001 Polymorphisms of the DNA repair gene XPD: correlations with risk of basal cell carcinoma revisited.
11335038 2001 Trichothiodystrophy, a transcription syndrome.
11319176 2001 Associations between ERCC2 polymorphisms and gliomas.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11309287 2001 An intronic poly (AT) polymorphism of the DNA repair gene XPC and risk of squamous cell carcinoma of the head and neck: a case-control study.
11278765 2001 Transcriptional regulation of the TFIIH transcription repair components XPB and XPD by the hepatitis B virus x protein in liver cells and transgenic liver tissue.