Property Summary

NCBI Gene PubMed Count 554
PubMed Score 969.92
PubTator Score 997.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (544)

PMID Text
27057082 Evidence strongly indicated the prospect of ERCC1 C118T and C8092A as predictive biomarkers for platinum-based chemotherapy in Asian non-small cell lung cancer patients.
26905109 Identification of ERCC1 expression level of tumor tissues in non-small cell lung cancer patients before treatment was not useful in prediction of treatment response and prognosis.
26823845 the ERCC1 rs3212986 polymorphism was found to influence the response to chemotherapy and overall survival of gastric cancer patients.
26805762 Upon UVC radiation, Nlp interacts with XPA and ERCC1, and enhances their association
26782397 Logistic regression analysis was taken to analyze the association between ERCC1 and ERCC2 genetic polymorphisms and response to chemotherapy.
26722542 there is a significant difference in biological behavior between ERCC1 rs3212986 gene polymorphism and treatment outcome of gastric cancer.
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26662383 Patients with negative expression of ERCC1 in tumor tissues had a significantly longer median DFS and median OS compared to patients with positive expression of ERCC1
26415382 ERCC1 genetic polymorphisms serve as important drug resistance genetic markers of ovarian neoplasms towards platinum drugs. (Review)
26400354 ERCC1 rs11615 polymorphism might influence the response to cisplatin-based chemotherapy and affect the clinical outcome for osteosarcoma patients.
26372896 oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels; bevacizumab induces VEGFA expression in metastatic colorectal cancer
26345951 the influence of four single nucleotide polymorphism in ERCC1 and ERCC2 on the response to cisplatin-based treatment and on clinical outcome in patients with osteosarcoma, was investigated.
26339355 ERCC1 rs11615 and ERCC1 rs2298881 genetic polymorphisms are significantly associated with poor response to chemotherapy and unfavourable survival of osteosarcoma.
26336131 Inhibition of DNA-repair genes Ercc1 and Mgmt enhances temozolomide efficacy in glioma treatment.
26253951 ERCC1/2 SNP, predict radiation dose-response and potentially guide personalized radiotherapy in non-small cell lung cancer.
26200905 Predictive and Prognostic Value of Ribonucleotide Reductase Regulatory Subunit M1 and Excision Repair Cross-Complementation Group 1 in Advanced Urothelial Carcinoma (UC) Treated with First-Line Gemcitabine Plus Platinum Combination Chemotherapy.
26191265 Suggest that ERCC1 rs3212986 and ERCC2 rs13181 gene polymorphism could influence the response to chemotherapy and clinical outcome of gastric cancer.
26165688 In advanced cervical squamous cell cancer, high ERCC1 was associated with advanced FIGO stage, progressive disease, and poor DFS in patients treated with cisplatin chemoradiotherapy.
26162296 ERCC1 may be a prognostic biomarker for urothelial carcinoma of the bladder. Patients with ERCC1 positive tumors may have better survival than those with ERCC1 negative tumors.
26125934 The ERCC1 wild-type carriers might attain a better rate of clinical response from a combined irinotecan and cisplatin regimen than ERCC1 wild-type/mutation carriers.
26125779 The expression of ERCC1 may be a sensitive prognostic indicator of concurrent chemoradiotherapy in locally advanced nasopharyngeal carcinoma.
26085086 F231L mutation results in only a small disturbance of the ERCC1-XPF interface, where, in contrast to Phe(231), Leu(231) lacks interactions stabilizing the ERCC1-XPF complex
26083491 Colorectal cancer patients with low expression of ERCC1 and thymidylate synthase have better response to therapy and show longer survival.
26074087 ERCC1 is located on human chromosome at 19q13.32 and comprises 10 exons spanning about 15 kilobases; 4our ERCC1 transcript isoforms are annotated, arising from alternative splicing. ERCC1 and ERCC4 genes encode the two subunits of the ERCC1-XPF nuclease. This enzyme plays an important role in repair of DNA damage and in maintaining genomic stability. [Review]
26066774 High ERCC1 expression was the only unfavorable independent determinant for OS.
26056042 this study showed that ERCC1 rs2298881C>A could predict the survival outcomes of patients with surgically resected early stage Non-Small Cell Lung Cancer.
26045829 our study found that ERCC1 rs11615 polymorphism can influence the chemotherapy response and overall survival of non-small cell lung cancer patients receiving cisplatin-based chemotherapy.
26025908 ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex. ERCC1-XPF and RPA form a DNA/protein complex on the nick DNA substrate.
26022132 ERCC1 rs11615 polymorphism is associated with increased risk of head and neck carcinomas.
26001533 DNA adduct levels in lung increased by 91.4% [95% confidence interval (CI), -32.5 to 442.5] for ERCC1 rs3212986 AA genotype and by 52.3% (95% CI, -23.1 to 201.5)for ERCC1 rs11617 CC genotype.
25973722 The role of conformational selection in the molecular recognition of the wild type and mutants XPA67-80 peptides by ERCC1 has been described.
25965418 The results show that the ERCC1 118 CC genotype confers better efficacy of NB-UVB therapy in patients with active vitiligo.
25961110 we aimed to analyze two polymorphisms for each of the DNA repair genes X-ray repair cross-complementing group 1 (XRCC1) and excision repair cross-complementing group 1 (ERCC1)
25946469 ERCC1 C118T genotype was significantly associated with both relapse-free survival (RFS) and overall survival
25941922 Interference of ERCC1 promoted the apoptosis of SKOV3/DDP cells and prevented cell mitosis by inducing G0/G1 phase arrest.
25906447 The dihydropyrimidine dehydrogenase and ERCC1 expression profile could potentially serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25867436 Studies suggest that the ERCC1 protein rs3212986 polymorphism was associated with a higher susceptibility to glioma, but no significant association between ERCC2 protein rs13181 polymorphisms and glioma risk.
25840756 ERCC1 expression was identified as independent prognosticators for freedom from recurrence of malignant pleural mesothelioma in patients undergoing induction chemotherapy followed by extrapleural pneumonectomy.
25754170 ERCC1 could be a fine prognostic factor of HNSCC and can also prompt the treatment response, which might be proven by further multicenter clinical trials
25730007 we found no association between the rs11615 of the ERCC1 and rs2276466 of the XPF polymorphisms and the risk of colorectal cancer
25690281 XRCC1 and ERCC1 polymorphisms probably affect susceptibility, chemotherapy response and survival of colorectal cancer patients.
25684513 ERCC1 gene polymorphism is not correlated with the radiotherapy-based multimodality treatment in rectal cancer.
25674197 ERCC1 expression was a prognostic factor and predictive marker in non-small cell lung cancer , and gastric cancer after surgery alone, but was not a prognostic factor in breast cancer.[review]
25647444 tumoral ERCC1 mRNA levels were lower in patients homozygous for ERCC1-C8092 as compared with the patients carrying the A allele
25600168 The ERCC1 level at diagnosis is predictive for the outcome of patients with non-metastatic, high-grade osteosarcoma (OS) treated with neoadjuvant chemotherapy, and co-evaluation with ABCB1 can identify high-risk groups of OS patients who are refractory to standard regimens.
25596702 we evaluated the association of gene polymorphisms, including the repair genes of XRCC1, ERCC1, ERCC2 (XPD), and TP53, with RFS in patients with non-small cell lung cancer
25560468 we first examined the relationship between mRNA expression (RRM1, ERCC1, ABCB1 and MTHFR) and chemosensitivity to cisplatin and gemcitabine in 17 NSCLC cell lines
25542228 our results suggest that ERCC1 rs11615, ERCC2 rs1799793, and NBN rs1805794 polymorphisms in the DNA repair pathways may influence the response to chemotherapy and OS of gastric cancer.
25538220 these results establish USP45 as a new regulator of XPF-ERCC1 crucial for efficient DNA repair
25533188 The SLX4 complex is a SUMO E3 ligase that SUMOylates SLX4 itself and the XPF subunit of the DNA repair/recombination XPF-ERCC1 endonuclease.
25501233 Results show that low ERCC1 mRNA expression was associated with better response to chemotherapy and correlated with longer survival in advanced non-small cell lung cancer Chinese patients treated with platinum-based chemotherapy.
25495407 Two SNPs associated with docetaxel toxicity were identified: CYP3A4*1B with infusion-related reactions; and ERCC1 Gln504Lys with mucositis (
25434755 it is confirmed that ERCC1 is a chemotherapy-tolerating gene and a promising predictor in tailoring chemotherapy of non-small cell lung cancer
25375151 Analysis indicated that positive/high ERCC1 expression was associated with unfavorable overall survival suggesting it as a prognostic factor in cell lung cancer patients receiving platinum-based chemotherapy.
25366790 Data show that excision repair cross-complementation group 1 (ERCC1) rs11615 and rs3212986 polymorphisms were associated with poor response to chemotherapy and shorter survival time of advanced non-small cell lung cancer (NSCLC).
25366763 Gastric cancer patients with the ERCC1 rs11615 TT genotype and the T allele showed a significant poorer response to chemotherapy compared to the wild-type genotype.
25339033 ERCC1 C118T polymorphism is associated with response to oxaliplatin in cervical cancer.
25253066 ERCC1 8092A and 19007C genotypes or their combination may predict a favorable prognosis in T4 breast cancer patients undergoing a platinum-based treatment
25250341 Genetic polymorphisms of ERCC1 and TP53 are risk factors for nephrotoxicity.
25246386 genetic polymorphism is not associated with differences in disease control rate and progression-free survival in malignant pleural mesothelioma patients
25227663 concomitant low expression levels of ERCC1, RRM1, and RRM2 and the high expression level of BRCA1 were predictive of a better outcome.
25217323 ERCC1 was not associated with OS (p = 0.17) or DFS (p = 0.13) in patients with resected NSCLC. ERCC1 is not a sensible marker for the choice of treatment in clinical patients with resected NSCLC.
25192052 ERCC1 homozygous deletion was found in 24% of gemistocytic astrocytomas.
25191856 ERCC1 single nucleotide polymorphism C8092A, but not its expression is associated with survival of esophageal squamous cell carcinoma patients.
25155628 Polymorphism studies and linkage analysis in South Indian population compared to other HapMap show that genotype frequencies of ERCC1 (19007C > T, rs11615;8092C > A, rs3212986) and ERCC2 (Asp312Asn, rs1799793) genes are ethnic dependent.
25107571 Advanced non-small cell lung cancer patients with both apurinic/apyrimidinic endonuclease 1 - and ERCC1 negative tumors had higher response rate to platinum-paclitaxel chemotherapy , longer progression-free survival and overall survival.
25076246 Low ERCC1 expression is associated with prolonged survival in patients with locally advanced nasopharyngeal cancer receiving cisplatin-based concurrent chemoradiother. ERCC1 expression may become a molecular marker for predicting clinical outcome.
25051148 This meta-analysis suggests that the ERCC1 19007T>C polymorphism may be associated with lung cancer risk in Asians
25042384 Patients with ERCC1-negative tumors show a benefit from neoadjuvant chemoradiation
25028118 various number of 28-bp tandem repeats in 5'-UTR region of TS gene, single nucleotide polymorphism (SNP) within the second tandem repeat of TS gene (G>C); 77C>T SNP in MTHFR; 19007C>T SNP in ERCC1
25025378 The ERCC1 Cys8092Ala polymorphism is an independent predictor of response to radiotherapy for NPC, and the XRCC1 Arg399Glu mutation combined with smoking status seems to predict PFS as well.
24994039 High ERCC1 expression might be an adverse prognostic and a drug-resistance predictive factor for advanced gastric cancer patients
24958519 Genetic polymorphism of ERCC1 correlated with response to platinum-based chemotherapy in non-small cell lung cancer Chinese patients.
24935625 ERCC1 protein expression might play an important role in the prognosis of locally advanced stage III non-small cell lung cancer patients treated with cisplatin-based adjuvant chemotherapy.
24935356 ERCC1 was identified as poor prognostic factor in patients with malignant pleural mesothelioma.
24870596 Studies suggest that ERCC1 protein expression might be a useful biomarker to predict response and survival for gastric cancer patients receiving platinum-based chemotherapy.
24861646 The rs3212986 and rs11615 ERCC1 polymorphisms are associated with risk of colorectal cancer in a Chinese population, especially in smokers.
24859833 ERCC1 rs11615 and rs3212986 polymorphisms may be helpful for designing individualized cancer treatment for non-small cell lung cancer patients
24854656 we found that low expression of ERCC1 and BRCA1 can be useful for selecting NSCLC patients who would benefit from chemotherapy and warrants further investigation in prospective studies.
24841208 ERCC1 rs3212948 G>C is a lung cancer risk-associated polymorphism.
24833529 The results indicated that Oxaliplatin sensitivity was significantly associated with ERCC1 C118T polymorphism in Asian people.
24817012 ERCC1 protein synthesis was compared with cell cycle distribution using combined immunocytochemistry and flow cytometry
24795708 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24793015 individuals carrying ERCC1 rs11615 GA and AA genotype had 1.91 and 2.66 risk of death when compared with those carrying GG genotype.
24782032 ERCC1 rs2298881 polymorphism is associated with risk of glioma in codominant, dominant, and recessive models, especially in males, smokers, and high-grade glioma cases.
24780295 Our data suggest a role for EGFR in DNA repair independent of DNAPKcs but dependent on ERCC1.
24763305 the AA genotype of ERCC1 C8092A polymorphism might increase the susceptibility of glioma in the Chinese population.[meta-analysis]
24762590 ERCC1 mRNA levels were higher in metastatic adenocarcinoma NSCLC; TUBB3 mRNA levels were significantly higher in poorly differentiated tumors and in advanced stage NSCLC, which indicates the poor prognosis.
24761869 High ERCC1 expression is associated with non-small cell lung cancer.
24737474 Our study indicated that the ERCC1 rs11615 and rs2298881 polymorphisms are associated with breast cancer in a Chinese population.
24699918 The results of the present study showed that drug resistance to DDP in gastric carcinoma is correlated with increased expression of ERCC1.
24662920 Loss of the structure-specific endonuclease ERCC1-XPF (ERCC4) is synthetic lethal with ATR pathway inhibitors. ERCC1-deficient cells exhibited elevated levels of DNA damage.
24585004 Results show that ERCC1 and Tau might serve as biomarkers of DNA repair and for paclitaxel sensitivity.
24563277 genetic variations in ERCC1 rs11615 and ERCC5 rs17655 are associated with laryngeal cancer risk in a Chinese population, especially in ever smokers and drinkers.
24532427 The gene polymorphisms in CHEK2, GSTP1, and ERCC1 may be involved in glioblastoma in the Han Chinese population.
24531312 The ERCC1 C8092A polymorphism AA and CA/AA variant genotypes were associated with a significantly increased risk of colorectal cancer, compared with the CC genotype.
24528857 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24499239 The AA genotype of the rs3212986C/A polymorphism in ERCC1 is associated with progression-free survival of epithelial ovarian cancer patients. [Meta-analysis]
24460276 High ERCC1 expression is associated with drug resistance in ovarian cancer.
24453030 results from our meta-analysis support the view that common variants in ERCC1 may contribute to susceptibility to glioma, especially in Asians
24443257 Our results suggest that ERCC1 and BRCA1 mRNA expressions are associated with progression-free survival and overall survival in advanced non-small cell lung cancer patients treated with platinum-based chemotherapy.
24412650 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24403494 Low ERCC1 expression is associated with response to therapy in primary ovarian cancer.
24403493 High ERCC1 expression is associated with resistance to platinum-based chemotherapy in primary ovarian cancer.
24403450 Reduced ERCC1 expression is associated with increased chemosensitivity in uterine cervical adenocarcinoma.
24370899 patients carrying the ERCC1 rs3212986 AA genotype were significantly associated with increased risk of death from non-small cell lung cancer when compared with those with CC genotype as a reference variable
24340057 Genetic variations in radiation and chemotherapy drug action pathways and survival in locoregionally advanced nasopharyngeal carcinoma treated with chemoradiotherapy.
24338713 meta-analysis suggested that the ERCC1 C118T, ERCC2 Asp312Asn, and Lys751Gln may be useful biomarkers to predict the clinical outcomes of the platinum-based chemotherapy in non-small cell lung cancer patients
24326865 patients with advanced biliary tract cancer treated with first-line gemcitabine plus cisplatin, IHC expression of ERCC1 was not either predictive or prognostic.
24318989 ERCC1 (rs11615, rs3212986C>A, and rs2298881) and ERCC4 (rs226466C>G, rs2276465, and rs6498486) were selected and genotyped
24254311 indicate that the AA genotype of ERCC1 C8092A may be associated with a higher risk of adult glioma than the CA and CC genotypes and that the risk allele of ERCC2 K751Q confers a significant susceptibility to adult glioma, especially in Asian populations
24220697 shows that the ERCC1 C118T variants are not associated with survival in advanced colorectal cancer patients treated with oxaliplatin or the in vitro sensitivity and DNA-repair capacity in 118C and 118T transfected cell lines
24175850 High ERCC1 expression is associated with gastric cancer.
24158589 this study explores the link between the ERCC1 deleterious variants and cisplatin chemotherapy for various cancers with the help of molecular docking and molecular dynamic approaches.
24144331 ERCC1-19q13 copy number gains occur frequently in stage III CRC and influences survival in patients with colon tumors.
24140460 Haplotype ERCC1 rs3212980 polymorphism is associated with lung cancer risk.
24135250 The mRNA expression level of STMN1, TOP2A and ERCC1 are correlated with non-small cell lung carcinoma pathology type in Chinese patients.
24125975 ERCC1 codon 118 C/T polymorphism was not associated with ERCC1 mRNA and protein expression, FOLFOX-4 response, and progression-free survival (PFS) or overall survival (OS).
24088734 ERCC1 expression levels are predictive of treatment outcome in squamous cell head and neck cancers.
24045016 We observed an increase of ORR in NSCLC patients when they were treated with chemotherapy according to ERCC1 and RRM1 SNPs status.
24036546 The ERCC1 202 isoform is the sole one endowed with ERCC1 activity in DNA repair pathways.
24023723 ERCC1 and ERCC2 functional SNPs may jointly affect OS in Caucasian gastric cancer patients.
23996617 ERCC1 overexpression is an important predictor of early failure in patients with stage III CRC.
23993732 we conclude that ERCC1 expression as a prognostic biomarker in NSCLC still requires further evaluation and clarification.
23982883 Overexpression of ERCC1 decreased drug sensitivity in malignant melanoma.
23982437 The analysis of RRM1 (-37C>A) more than ERCC1 (19007C>T) polymorphism may be a promising tool in the qualification of NSCLC patients for chemotherapy containing platinum compounds and gemcitabine.
23948418 The expressions of MDR-1, RRM-1, EGFR, ERCC-1 were observed in a variety of pathological types of NSCLC.
23940741 A significant correlation between ERCC1 expression and EGFR mutation, and ERCC1-negative patients with exon 19 deletion had a longer progression free survival than the other patients.
23912706 Report synergistic effect of combined treatment with resveratrol and pemetrexed in human NSCLC cells through downregulation of the MKK3/6-p38 MAPK-ERCC1 signaling pathway.
23909490 The present study shows that the ERCC1 rs11615 and XPF rs6498486 polymorphisms are associated with breast cancer risk in a Chinese population.
23884439 ERCC1 is an independent prognostic factor for overall survival in the first-line treatment of gastric cancer.
23846458 the present study is the first to show that high ERCC1 expression in squamous cell carcinoma of the oropharyngnx predicts improved prognosis.
23817665 b-elemene abrogated cisplatininduced expression of excision repair cross-complementation group1 (ERCC-1), a marker gene in the nucleotide excision repair pathway that repairs cisplatin-caused DNA damage.
23810210 ERCC1 codon 118 polymorphism is associated with malignant pleural mesothelioma.
23807173 study of the association between ERCC1 and XPA proteins and their polymorphisms with cisplatin sensitivity and overall survival of patients with non-seminomatous testicular germ cell tumours; high levels of ERCC1 were associated with non-cisplatin sensitivity
23773262 19q13-ERCC1 gene copy number increase is associated with non--small-cell lung cancer
23759026 ERCC1 protein expression might play an important role in the prognosis of p-stage III/N2 NSCLC patients treated with cisplatin-based adjuvant chemotherapy.
23746523 structure and dynamics of the XPA binding motif in ERCC1
23727606 ERCC1 C118T polymorphisms may serve as a biomarker for lung cancer risk and have prognostic value in patients with advanced non-small cell lung cancer (NSCLC) undergoing platinum-based treatment.
23719746 High ERCC1 tumor expression was associated with decreased overall survival (OS) in the patients who received chemotherapy but was associated with increased OS in those who underwent surgery alone.
23712330 ERCC1 polymorphism might be a useful predictive marker in metastatic/recurrent nasopharyngeal carcinoma
23702380 ERCC1 expression correlated significantly with favorable prognostic factors, such as smaller tumor size and ER-positivity, suggesting a possible role for ERCC1 as a predictive and/or prognostic marker in breast cancer.
23684781 white patients carrying heterozygous or variant genotypes at the ERCC1 locus had a >3-fold longer median progression-free survival and 5-fold longer median overall survival than did patients carrying only wild-type alleles
23674849 Emodin markedly reversed oxaliplatin resistance in HepG2 cells by inhibiting ERCC1 expression vial FGFR2 signaling pathway.
23632208 Polymorphisms in ERCC1, codon-118 and MMS19 genes are not associated with clinical response to platinum or survival.
23623389 Malfunction of nuclease ERCC1-XPF results in diverse clinical manifestations and causes Cockayne syndrome, xeroderma pigmentosum, and Fanconi anemia.
23593158 the variant genotypes of ERCC1 rs3212986 and ERCC2 rs238406 are associated with decreased repair efficiency of BPDE induced DNA damage, and may be predictive for an individual's DNA repair capacity in response to environmental carcinogens.
23581229 Patients with an unchanged EGFR mutational status after chemotherapy were more likely to express ERCC1, and this change may serve as a clinical indicator of therapy response
23580445 The compound interacts with the domain of XPF responsible for interaction with ERCC1.
23549037 Study confirms the prognostic role of ERCC1 expression and XRCC1 (Arg399Gln) polymorphism in advanced NSCLC treated with first-line chemotherapy.
23523421 Low ERCC1 expression was associated with longer overall survival in patients with pulmonary adenocarcinoma who were treated with pemetrexed/cisplatin as first-line chemotherapy.
23514287 Immunohistochemical analysis with the use of currently available ERCC1 antibodies did not specifically detect the unique functional ERCC1 isoform. As a result, its usefulness in guiding therapeutic decision making is limited.
23496813 ERCC1 and BRCA1 mRNA expression levels correlate inversely to CRC metastasis. ERCC1 and BRCA1 might serve as biomarkers for lymphatic metastasis and as prognostic indicators for CRC; their down-expressions are predictors of poor outcome in CRC patients
23481186 Low ERCC1 expression is associated with treatment response in colon cancer.
23435956 individuals whose expression of XRCC1, ERCC4, ERCC2, and ERCC1 are reduced may be at a higher risk of developing squamous intraepithelial lesion which eventually leads to invasive cervical carcinoma.
23401439 ERCC1 biomarkers may represent a major step toward biology-based prescription of cytotoxic compounds for lung neoplasms.
23275151 Collectively, these data suggest that there is a synergistic relationship between PARP inhibition and low ERCC1 expression in NSCLC that could be exploited for novel therapeutic approaches in lung cancer therapy based on tumor ERCC1 expression.
23272099 analysis of novel inhibitors that block XPA-ERCC1 binding
23263828 Our study indicates that the expression of ERCC1 evaluated by immunohistochemistry is a promising predictive marker for response in patients with metastatic esophageal squamous cell carcinoma receiving cisplatin-paclitaxel regimen.
23259415 Low ERCC1 mRNA level appears to be a highly specific predictor of response to cisplatin-based concurrent chemoradiotherapy in locally advanced cervical squamous cell carcinoma.
23244079 Single nucleotide polymorphism in XRCC1 gene is associated with glioma.
23203453 ERCC1 is associated with a diminished capacity of repairing BPDE-DNA adducts and may be used as a valid biomarker to predict an individual's risk to develop cancer upon exposure to environmental carcinogens.
23171216 ERCC1 is being explored as a predictive diagnostic biomarker for cisplatin-based chemotherapy.To develop the best mAb for ERCC1 IHC analysis, 18 monoclonal antibodies were generated and 6 of them were screened against our protein microarray chip.
23166636 Functional ERCC1 single nucleotide polymorphisms may contribute to risk of gastric cancer.
23155271 We assessed the relation of mRNA levels of ERCC1, RRM1, and BRCA1 to survival in surgically-resected tumor tissues from patients who underwent adjuvant chemotherapy
23148636 19007C>T polymorphisms of ERCC1 , especially in its homozygotic state, but not 8092C>A polymorphism, could be a useful prognostic marker in advanced UC treated with platinum-based chemotherapy.
23147699 an important role of ERCC1 codon 118 polymorphisms for a biomarker to chronic benzene poisoning in the Chinese occupational population
23147544 Less intensive doses of cisplatin and docetaxel are active but not effective in reducing toxicity; Also, both ERCC1 and RASSF1A might be useful prognostic markers in this regimen.
23098477 ERCC1 gene polymorphisms are associated with bone neoplasms.
23095216 The results of this study demonistrated that ERCC1 shows a highly significant correlation with Alcohol use disorders-induced decreases in the volume of the left parietal supramarginal gyrus and neuropsychological measures.
23086647 The expression of RRMI and ERCC1 genes in tumor tissues and RRM1 in peripheral blood lymphocytes is closely correlated with the response to chemotherapy and prognosis of patients with advanced non-small cell lung cancer.
23011763 ERCC1 expression had no predictive value in head and neck carcinoma patients treated with definitive radiotherapy (DR) or adjuvant radiotherapy (AR).
22994779 GSTP1 Val/Val, ERCC1 C/C and ERCC2 G/G were also related to longer survival among patients with colon cancer.
22938460 data indicated that polymorphisms in ERCC1 and XPD have a role in the susceptibility and survival of glioma
22932088 The results indicated that platinum-based chemotherapy sensitivity was significantly associated with polymorphism of ERCC1 C118T and MDR1 C3435T SNP.
22897321 ERCC1 C19007T polymorphism might not be associated with the risk and invasiveness of cervical cancer in Korean women.
22890830 High expression of ERCC-1 is associated with metastatic lymph nodes of patients with non-small cell lung cancer adenocarcinoma.
22863869 Data suggest that excision repair cross-complementation group 1 enzyme (ERCC1) may represent a potential predictive marker for platinum-based treatment in bladder cancer.
22821389 SNP markers on ERCC1 may predict the response to imatinib therapy, which proposes the potential involvement of the DNA repair machinery in the mechanism of imatinib action in chronic phase CML.
22740205 High ERCC1 expression is associated with triple negative breast cancer.
22609620 ERCC1 mRNA levels in tumors correlated with outcome in patients with epithelial ovarian cancer treated with intraperitoneal cisplatin.
22571922 High tumor ERCC1 expression predicts low chemotherapy response and poor survival mainly caused by more metastasis in locoregionally advanced NPC treated with cisplatin-based induction chemotherapy
22569992 High tumor expression of RRM2 and ERCC1 are associated with reduced recurrence free survival and overall survival after resection of pancreas cancer.
22555222 Low expression of ERCC1 on circulating tumor cell (CTC) correlates with Progression-free survival (PFS) in patients with metastatic NSCLC receiving platinum-based therapy.
22547097 Multiple DNA binding domains mediate the function of the ERCC1-XPF protein in nucleotide excision repair
22457069 XPF-ERCC1 has a preference for cleaving the phosphodiester bond positioned on the 3'-side of a T or a U, which is flanked by an upstream T or U suggesting that a T/U pocket may exist within the catalytic domain.
22439756 ERCC1 and BAG-1 are determinants of survival after surgical treatment of NSCLC, and its mRNA expression in tumor tissues could be used to predict the prognosis of NSCLC treated by platinum.
22374244 ERCC1 +262A/A genotype may reduce the risk of gastric cardia adenocarcinoma for nonsmokers.
22351191 Highly significant differential distributions of haplotypes defined by both nine haplotype-tagging SNPs covering ERCC2 and PPP1R13L and fourteen haplotype-tagging SNPs covering ERCC2, PPP1R13L, and ERCC1 were found.
22344449 In survival analyses, a significant correlation between a better progression free survival with a low TOP I RNA expression as well as a negative ERCC1 inmunostaining were found.
22331726 ERCC1 protein expression could potentially be used to customize chemotherapy by defining subsets of patients who would benefit the least from platinum-based chemotherapy.
22329723 The 19007T/C polymorphism may be a useful prognostic marker in patients with EOC treated with platinum-based chemotherapy in Chinese women
22302397 High ERCC1 levels were associated with shorter survival and lower response to chemotherapy in advanced non-small cell lung cancer patients received palliative chemotherapy. [Meta-analysis]
22266871 inhibition of Gli1 by a specific shRNA inhibits the upregulation of c-jun Ser63/73, and also inhibits the upregulation of three genes essential to NER (ERCC1, XPD) and base excision repair (XRCC1).
22261301 ERCC1 expression has limited clinical value in patients with advanced EOC treated with platinum and taxane based chemotherapy.
22212909 ERCC1-XPF dependent DNA repair is critical for protecting prostate epithelial from transformation to cancer
22203729 Data show that PGP and ERCC1 were significantly upregulated in recurrent lesions from patients with advanced stage ovarian serous carcinoma.
22201261 polymorphisms C8092A and T19007C in ERCC1 gene were not associated with the risk of glioma in a Chinese population.
22199271 ERCC1 expression does not seem to play a role in improved outcomes in head and neck cancer treated with concurrent cisplatin and radiation
22177891 There is a positive correlation between the differentiation of squamous cell nasopharyngeal carcinoma with ERCC1 expression, and this in turn predicts prognosis and overall outcome after treatment.
22176134 The paradoxical role of the molecular alter-ations of ERCC1 in carcinogenesis and response to treatment of head and neck squamous cell carcinoma are intriguing and deserve further investigation.
22159227 Tip60 and E2F1 are involved in the upregulation of the ERCC1 expression.
22110208 High ERCC1 is associated with treatment response in colorectal cancer.
22102173 The allelic frequencies of the ERCC1 codon 118 were found to be 60.6% (C/C), 33.1% (C/T), and 6.3% (T/T), respectively.
22093627 FISH-positive EGFR expression is associated with gender and smoking status, but not correlated with the expression of ERCC1 and BRCA1 proteins in non-small cell lung cancer.
22053010 Data suggest that in non-small cell lung cancer (NSCLC) cells, ERCC1 is induced by etoposide through the p38 MAPK pathway, and this phenomenon is required for NSCLC survival and resistant DNA damage.
22034895 ERCC1 expression may be a useful biological predictive marker for advanced uterine cervical cancer treated with concurrent chemoradiotherapy
22022380 Current evidence suggests high ERCC1 may adversely influence survival and response in platinum-treated non-small cell lung cancer patients.
22002622 ERCC1 17677A > C and ERCC1 19007T > C polymorphisms, but not the ERCC1 8092C > A polymorphism, are low-penetrance risk factors for cancer development.
21971700 high expression of ERCC1, XPB and ILF3 was observed in human epithelial ovarian cancer
21956434 Analysis of ERCC1 (rs11615) gene polymorphisms reveals a significant correlation with response and survival in patients with adenocarcinoma of the esophagus treated with a neoadjuvant radiochemotherapy.
21942242 Results indicate that ERCC1 and GSTT1-null polymorphisms may have an effect on acute myeloid leukemia (AML) risk that is dependent on smoking exposure.
21940361 Immunohistochemical studies for ERCC-1 and GST-p may be useful in prediction of the response to 5-fluorouracil/oxaliplatin chemotherapy in advanced colorectal cancer patients.
21933627 Data found little evidence of an association between the T1900C or C8092A polymorphisms of ERCC 1 and the risk of lung cancer in Caucasian or Han Chinese people.
21902499 Genetic polymorphisms in ERCC1 may be valuable predictors of cisplatin-induced nephrotoxicity.
21899657 Expression of excision repair cross-complementation group 1 (ERCC1) is correlated with a favourable prognosis in patients who have undergone surgical resection of non-small cell lung cancer.
21896658 collaboration between hSNM1A and XPF-ERCC1 is necessary to initiate ICL repair in replicating human cells
21875468 Non-small cell lung cancer patients with up-regulated ERCC1 expression have a poor survival rate.
21839691 This work reveals a new role for ERCC1 distinct from its known function in DNA repair, which may be independent of XPF.
21827803 found no evidence to support the use of ERCC1 C118T/C8092A polymorphisms as prognostic predictors of platinum-based chemotherapies in NSCLC
21788964 Baseline TS and ERCC-1 levels may allow the selection of patients who benefit from FOLFOX4 chemotherapy
21766907 Data did not find significant associations between any of these polymorphisms and progression-free survival, nor did we observe any difference in progression-free survival according to ERCC1 expression.
21750204 ERCC1-negative non-small-cell lung cancer (NSCLC) had a higher rate of genomic abnormalities vs ERCC1-positive tumors; ERCC1-positive tumors seemed to share a common DNA damage response (DDR) phenotype with the overexpression of seven genes linked to DDR
21726821 ERCC1 gene polymorphism is not associated with chemotherapy-induced neutropenia non-small-cell lung cancer.
21720251 High ERCC1 expression was associated with worse disease-free survival in uterine cervical adenocarcinoma patients who received adjuvant cisplatin-based chemotherapy or chemoradiotherapy with cisplatin.
21601580 data suggest that common genetic variations in ERCC1 may influence increased risk of smoking-related lung cancer and one of the causative effectors may locate around or within ERCC2
21597406 The level of ERCC1 expression in tumors is a strong predictor of survival in resected non small cell lung carcinoma patients untreated without pre- or post-operative chemotherapy and/or radiotherapy.
21553054 In stage III non-small cell lung cancer, ERCC1 DNA amplification and mRNA expression levels were higher, but protein overexpression was lower, than stage II and I.
21553053 Harboring at least one 19007C allele may have protective effect in non-small cell lung cancer.
21529986 low expression correlates with better response to chemotherapy and longer survival in patients with advanced non small-cell lung cancer
21496891 The polymorphism in codon 118 in the DNA repair gene ERCC1 was an independent predictor for better survival in EOC/PPC/FTC patients treated with intravenous carboplatin- and paclitaxel-based chemotherapy.
21450455 Topo2A has a role in chemosensitivity, and ERCC1 has a role in survival in locally advanced soft tissue sarcomas
21426588 A high expression of ERCC1 predict a poor response and survival to cisplatin-based induction chemotherapy.
21418871 Gastric cancer patients with ERCC1-118 C/C genotype and XRCC1-399A/G or A/A genotype may benefit from an oxaliplatin-based adjuvant chemotherapy.
21394302 expression of ERCC1 is particularly lower in negative breast cancers than other types of breast cancers
21360249 High ERCC1 is associated with treatment response in pancreas adenocarcinoma.
21355309 ERCC1 expression in platinum-resistant epithelial ovarian carcinoma patients' tissues was significantly higher than that in platinum-sensitive patients' tissues.
21323960 epithelial cells from premalignant to malignant lip disease exhibited changes in the expression of ERCC1 proteins; these molecular change might contribute to lip carcinogenesis.
21289518 High ERCC1 is associated with thymic epithelial tumors.
21286668 Genetic polymorphisms of ERCC1 is correlated with the efficacy of cisplatin-based chemotherapy in cases of advanced esophageal carcinoma.
21278243 ERCC1 and ERCC2 polymorphisms predict clinical outcomes of oxaliplatin-based chemotherapies in gastric and colorectal cancer
21262916 Data indicate there were no significant associations among ERCC1 protein expression, TS and ERCC1 polymorphisms, and clinical outcome.
21206986 High ERCC1 expression seems to be associated with better overal survival rates in head and neck squamous cell carcinoma patients submitted to adjuvant cisplatin-based chemoradiation.
21177407 Results suggest that ERCC1 expression level may predict the efficacy of CRT for MIBC.
21165580 Tanshinone IIA acts via p38 MAPK to induce apoptosis and the down-regulation of ERCC1 and lung-resistance protein in cisplatin-resistant ovarian cancer.
21117025 Patients with ERCC1-positive status with subserosal gallbladder carcinomas had significantly better survival than ERCC1-negative patients at 20 and 60 months of follow-up.
21093896 The ERCC1 expression patterns in pretreatment specimens may thus facilitate the prediction of responses to cisplatin-based NAC. We propose that patients expressing low levels of ERCC1 derive the most benefit from cisplatin-based NAC.
21091775 Results suggest a negative contribution by ERCC1expression to PFS in metastatic urothelial carcinoma patients treated with cisplatin-based chemotherapy.
21076943 Increased ERCC1 expression is associated with cisplatin resistance in hepatocellular carcinoma.
21075476 genetic polymorphisms is not a prognostic predictor of platinum-based chemotherapy outcomes in non-small cell lung cancer
21075476 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21057378 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21048041 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21029695 Genetic polymorphisms of ERCC1-118, XRCC1-399 and GSTP1-105 are associated with time to progression and overall survival of advanced gastric cancer patients treated with oxaliplatin/5-Fu-based combination chemotherapy.
21029695 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21029626 An elevated expression of ERCC1 is an important factor for cisplatin insensitivity in non-small cell lung cancer.
20979931 Observational study of gene-disease association. (HuGE Navigator)
20975603 non-small cell lung cancer specimens harboring EGFR activating mutations are more likely to express low ERCC1 mRNA levels.
20957144 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20935060 Observational study of gene-disease association. (HuGE Navigator)
20868593 In postoperative NSCLC patients who are receiving adjuvant chemotherapy, ERCC1 expression has no effect on drug resistance.
20864414 Observational study of gene-disease association. (HuGE Navigator)
20863778 Study suggests that ERCC1 polymorphisms and haplotypes do not play a role in lung and H&N cancer susceptibility in Caucasians.
20863778 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20855270 Neoadjuvant chemotherapy can induce ERCC1 expression in elderly patients with non-small cell lung cancer.
20846399 Data indicate for the first time that the exceptional sensitivity of TTC and, therefore, very likely the curability of TGCT rests on their limited ICL repair due to low level of expression of ERCC1-XPF.
20823140 Activation of ERCC1 by Snail is critical in the generation of cisplatin resistance of head and neck squamous cell carcinoma cells.
20817763 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20736746 Observational study of genetic testing. (HuGE Navigator)
20734048 Observational study of gene-disease association. (HuGE Navigator)
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20728204 The Kaplan-Meier analysis revealed that the survival of patients with ERCC1-negative ovarian cancer (n=45; 62%) was significantly better (median survival 50.0 months) compared with the ERCC1-positive group (n=32; 38%; 20 months; p=0.004).
20689757 High MDR1 and ERCC1 gene expressions are associated with inferior outcome after cisplatin-based adjuvant chemotherapy for locally advanced bladder cancer.
20677561 The results suggest that there is no association between polymorphisms in ERCC1 C8092A and codon118 and response in patients with advanced non-small cell lung cancer receiving cisplatin-based chemotherapy.
20677561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20673527 The results suggest ERCC1 and PKCalpha might be correlated with the development of NSCLC. ERCC1 might be related to prognosis of non-small cell lung cancer.
20673515 ERCC1 and GST-pi are aberrant highly expressed in NSCLC with positive correlation, which indicate they might act synergistically in tumorigenesis of NSCLC. The positive expression of ERCC1 have better survival and may have effect on prognosis.
20651406 Increased ERCC1 protein expression is associated with suboptimal debulking in advanced epithelial ovarian cancer.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627363 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530282 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20518486 sites of interaction of FANCG with ERCC1, which is different from the region of ERCC1 that binds to XPF
20508946 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20504250 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20504223 High level of ERCC1 mRNA may serve as a useful prognostic factor for poor outcome in advanced NSCLC patients treated with platinum-based third-generation doublet chemotherapy
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20495366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20470393 Over-expression of Fas reverses drug resistance of H446/CDDP cells, possibly due to the increased cell sensitivity to apoptosis and the decreased expressions of GST-pi and ERCC1
20467918 ERCC1, RRM1 and BRCA1 are promising predictive and prognostic biomarkers in advanced non-small cell lung cancer.
20462983 Data show that overall survival was significantly improved in the patients with ERCC1 118 T/T or C/T treated by platinum-based chemotherapy.
20462983 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20429839 Observational study of gene-disease association. (HuGE Navigator)
20395129 Numerically more toxicity was observed in the entire population of ERCC1-negative tumours and reached significance in patients with adenocarcinomas regarding leukopenia (P=0.015), nausea/vomiting (P=0.040) and neurotoxicity (P=0.037).
20391138 Observational study of gene-disease association. (HuGE Navigator)
20385995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20368715 Observational study of gene-disease association. (HuGE Navigator)
20354815 results suggest that polymorphism Asn118Asn in ERCC1, A67T in iASPP and Asn148Glu in APE1 may associated with early onset of lung cancer as well as some specific subtype of lung cancer
20354815 Observational study of gene-disease association. (HuGE Navigator)
20351547 The C->T change of ERCC1 Asn118Asn polymorphism and the C->A change of ERCC1 Gln504Lys polymorphism have statistically significant association with elevated or descendent platinum-based chemotherapy response respectively.
20351547 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20332140 High ERCC1 is associated with non-small-cell lung cancer.
20331623 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20232390 Observational study of gene-disease association. (HuGE Navigator)
20221251 This demonstrates that at least part of the DNA repair defect and symptoms associated with mutations in XPF are due to mislocalization of XPF-ERCC1 into the cytoplasm of cells.
20216541 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211060 Compared with their parental cells, the expressions of CDA, RRM1, PTEN and ERCC1 increase in human gemcitabine-resistant non-small cell lung cancer cell lines.
20189873 There was no significant association between the ERCC1 C118T polymorphism and treatment response in advanced NSCLC patients.
20189873 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20143185 Platinum-based chemotherapy sensitivity was significantly associated with polymorphism of ERCC1 C118T.
20104194 High expression of ERCC1 in typical carcinoid is associated with the failure of platinum-based therapy.
20085902 Tau expression but not excision repair cross-complementing 1 in advanced breast cancer predicts poor response to combination chemotherapy of paclitaxel and cisplatin.
20070981 Two polymorphisms, C8092A and C118T, affected the prognosis of non-small-cell lung cancer patients who received adjuvant and/or neoadjuvant platinum-based chemotherapy.
20070981 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20061190 A single SNP analysis showed a significantly increased risk given by XRCC1-rs915927 and a protective effect of the rare alleles of 3 ERCC1 SNPs: rs967591, rs735482 and rs2336219.
20061190 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20047592 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20021611 determination of the expression of excision repair cross-complementation group 1 and class IIIbeta tubulin is useful to predict the effects of platinum-based anticancer drugs.
20009541 Data suggested that ERCC-1 was involved in the resistance of cetuximab combined with DDP.
20003463 Genetic polymorphisms in ERCC1 and XRCC1 genes might be prognostic factors in non-smoking female patients with lung adenocarcinoma.
20003463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20003391 Study aimed to investigate the association between the ERCC2 751, 312 and ERCC1 118 polymorphisms and the risk of lung adenocarcinoma in Chinese non-smoking females.
20003391 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19960344 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956886 ERCC1 and XPF are upregulated during testicular germ cell tumor progression
19940136 Data show that mutation of two conserved residues (Asn-110 and Tyr-145) located in the XPA-binding site of ERCC1 dramatically affected NER.
19922504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19878615 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19875192 mRNA expression predicts overall survival in patients with non-small cell lung cancer who received neoadjuvant cisplatin-based chemotherapy
19850635 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19832035 Results indicate that ERCC1 exon VIII alternative splicing does exist in some ovarian cancer cell lines, and regulates cisplatin-resistance in ovarian cancer cells.
19822419 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19805513 Data demonstrate that the unhooking of an interstrand cross-link by XPF-ERCC1 is necessary for the stable localization of FANCD2 to the chromatin and subsequent homologous recombination-mediated DSB repair.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786980 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19687761 overexpression of ERCC1 is associated with brain and adrenal metastases in non-small cell lung cancer.
19672255 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19667277 Data show that women who were ERCC1 negative did not have a survival advantage over ERCC1-positive women.
19664717 methylation status of ERCC1 is associated with radiosensitivity in glioma cell lines
19661343 Elevated ERCC1 gene expression in blood cells associated with exposure to arsenic from drinking water.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19636001 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19626585 aberrant CpG island methylation in ERCC1 promoter region exists in human glioma cell lines as well as clinical glioma samples
19625176 Observational study of gene-disease association. (HuGE Navigator)
19620936 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19580345 maintained expression and even up-regulation of some (PNPT1, PMPCB, HMMR/RHAMM, BSG and ERCC1) tumor associated antigens in CD40-activated leukemic cells.
19574766 Overexpression of ERCC1 is associated with platinum resistance in epithelial ovarian cancer.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19552012 The analysis of ERCC1 is useful to individualize therapy accordingly to individual levels which are modified by genetic mutations, and Polymorphisms in codons 118 C/T and C8092A, seem to influence the carcinogenesis, cytostatic resistance, survival.
19549713 No differences in survival or response rates of patients with recurrent Nasopharyngeal carcinoma treated with the GEMOX regimen were found between ERCC1 genotypes.
19549713 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19543324 Data show that the combination of RRM1 and ERCC1 expression is prognostic in pancreatic cancer patients after a complete resection.
19538866 Intratumoral ERCC1 mRNA expression is an independent predictive marker for survival of the patients with non-small cell lung cancer receiving platinum-based chemotherapy.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19513514 Examine role of ERCC1 polymorphisms in patient response to gastric cancers treated with FOLFOX or FOLFIRI.
19488864 Tumor ERCC1 expression is associated with tumor response and patient's survival in Chinese advanced non-small-cell lung cancer patients treated with platinum compounds.
19470925 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19434073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19421825 Single-nucleotide polymorphisms of ERCC1 and XRCC1 could be applied to further individualize treatment strategies.
19421825 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19362955 ERCC1 gene polymorphisms is associated with favorable clinical outcome in advanced non-small-cell lung cancer.
19362955 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19361884 The ERCC1 C8092A polymorphism may influence the non-small cell lung cancer prognosis regardless of the ERCC1 protein expression and platinum sensitivity.
19361884 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19332728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19318434 Single nucleotide polymorphisms in ERCC2, ERCC1, and GLTSCR1 are associated with a 23% reduction in glioblastoma risk.
19297315 ERCC1 and XPF are correlated and expressed at a higher level in NS(Never Smoking) compared with ES(Ever Smoking)
19289372 examined ERCC1, RRM1, XPG, and BRCA1 mRNA levels by real-time quantitative polymerase chain reaction in 54 patients with stage IB-IIB resected NSCLC.
19270000 Observational study of gene-disease association. (HuGE Navigator)
19258314 a model for the mechanism of ICL repair in mammalian cells that implicates the DNA glycosylase activity of NEIL1 downstream of XPF/ERCC1 and translesion DNA synthesis repair steps.
19257887 Observational study of gene-disease association. (HuGE Navigator)
19253035 platinum-based chemotherapy affects the expression of tissue marker (ERCC1)in lung cancer
19247656 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19240185 ERCC1 expression is the first factor for predicting survival in adrenocortical carcinoma patients treated with platinum-based chemotherapy.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19235214 lower levels of ERCC1 were found in patients with early aseptic loosening compared to patients with aseptic loosening later than 10 years
19203783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19194123 ERCC1 positives combined with thymidylate synthase, and glutathione S-transferase pi positives are associated with drug resistance in advanced colorectal cancer.
19173905 Decreased expression and mutation of ERCC1 gene may be a possible carcinogenic mechanism of CdCl2.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19150580 high expression is an independent prognostic factor for poor overall survival in advanced non-small cell lung cancer patients
19124499 The SNP of ERCC1 3' untranslated region (UTR) showed a significant association with glioma risk.
19124499 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19068092 ERCC1 codon 118 C-->T polymorphism is associated with FOLFOX-4 treatment in metastatic colorectal carcinoma.
19068092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19035454 DNA repair proteins BRCA1 and ERCC1 have roles in inhibiting progression of ovarian cancer
19029193 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19020759 Measurement of TS and ERCC1 mRNA levels in primary colorectal cancer can predict those in synchronous liver metastases, but not in metachronous ones.
19009659 ERCC1 polymorphism may be a useful predictive parameter for the relapse and survival of gastric cancer patients receiving oxaliplatin-based adjuvant chemotherapy.
19009659 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18990748 Meta-analysis of gene-disease association. (HuGE Navigator)
18990028 Observational study of gene-disease association. (HuGE Navigator)
18977553 the level of ERCC1 expression may predict survival in NSCLC patients receiving carboplatin and paclitaxel
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of excision repair cross-complementing rodent repair deficiency, complementation group 1 (ERCC1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18830263 Observational study of gene-disease association. (HuGE Navigator)
18823676 High ERCC1 expression was associated with drug resistance to platinum-based chemotherapy in non-small-cell lung cancer.
18797464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18756932 ERCC1 gene is associated with the resistance to cisplatin, and the sensitivity to cisplatin can be enhanced by RNA interfering ERCC1 in ovarian cancer.
18683754 By down-regulating ERCC1, BRCA1, hMLH1 genes, blocking G0/G1 phase, and increasing apoptosis rate, mifepristone could enhance anti-tumor effect of cisplatin.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18672388 Following ERCC1 depletion, FANCD2-Ub formation is reduced and FANCD2 foci are eliminated.
18640939 Although the ERCC1 codon 118 polymorphism does not seem to be associated with clinical outcome, the C8092A polymorphism was an independent predictor of survivalin women with optimally resected stage III epithelial ovarian cancer
18635523 Haplotypes of ERCC1 are significantly associated with high levels of DNA adducts compared with their most common haplotypes in normal human lymphocytes.
18635523 Observational study of gene-disease association. (HuGE Navigator)
18623378 ERCC1 overexpression is associated with resistance to platinum based chemotherapy in patients with nonsmall-cell lung cancer
18616887 ERCC1 and ERCC2 polymorphisms may have a role in idiopathic azoospermia in a Chinese population
18616887 Observational study of gene-disease association. (HuGE Navigator)
18615480 ERCC1 polymorphisms are associated with nasopharyngeal carcinoma.
18615480 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18604718 High expression of ERCC1, FLT1, NME4 and PCNA in myelodysplastic syndrome was associated with poor prognosis and disease progression along the sequence of 5q-syndrome/RCMD/RAEB/de novo AML
18594541 ERCC1 expression might be a predictive marker of survival in locally advanced SCCHN in patients treated with cisplatin-based CCRT.
18564169 expression of ERCC1 to b-actin was significantly higher (P < 0.01) in ZNRD1-espressing cells
18520795 ERCC1 was confirmed to be an independent prognostic factor for survival in LD patients. No significant role was found for ERCC1, RRM1 and TopoIIalpha in ED patients.
18509181 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18505590 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18494946 Significantly higher ERCC1 mRNA expression was found in SCLC compared weith NSCLC. There was no correlation between mRNA expression of the ERCC1 gene and chemosensitivity to cisplatin, carboplatin, or gemcitabine.
18483312 Observational study of genotype prevalence. (HuGE Navigator)
18478337 Polymorphisms of ERCC1 are associated with esophageal adenocarcinoma risk.
18478337 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18451256 study identified 2 functional variants in the ERCC1 5'-flanking region, -433T>C & 262G>T, which cooperatively influence transcriptional regulation of ERCC1; the -433C & 262G alleles are associated with susceptibility to lung cancer
18451256 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18430179 demonstrates increased survival for neoadjuvant treated esophageal adenocarcinoma with TS, ERCC1, or GSTP-1 mRNA level at or below the median
18425336 ERCC1 polymorphism may be a useful prognostic marker in patients with pancreatic cancer treated with platinum-based chemotherapy.
18396111 To determine whether a human flap endonuclease could recognize and process this potential intermediate, the genetic requirement for the ERCC1/XPF heterodimer during LINE-1 retrotransposition was characterized
18395930 loss of ERCC1 and class III beta-tubulin protein expression were predictors of better survival in non-small-cell lung cancer patients who received a platinum-based plus taxane chemotherapy.
18386788 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18358500 Observational study of gene-disease association. (HuGE Navigator)
18347182 Correlation of CDA, ERCC1, and XPD polymorphisms with response and survival in gemcitabine/cisplatin-treated advanced non-small cell lung cancer patients.
18347182 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18332046 Significantly lower ERCC1 expression is associated with prostate cancer
18332046 Observational study of gene-disease association. (HuGE Navigator)
18289367 The previously identified haplotype of ERCC1 and its present polymorphisms are not associated with an increased risk for colorectal cancer.
18289367 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18204222 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18204222 in our study ERCC1 was not associated with any clinical characteristic of colorectal cancer
18081788 Upregulation of ERCC1 and XPD protein expression was associated with resistance process to platinum-based chemotherapy in advanced epithelial ovarian cancer
18036700 ERCC1 expression was identified as a positive prognostic marker in resected non-small cell lung cancer
18026184 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18024864 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18006494 These results implicate the XPF-ERCC1 complex in initiating interstrand cross-links (ICL) repair by unhooking the ICL, which simultaneously induces a double strand break at a stalled fork.
17987380 ERCC1 expression could be useful in identifying patients who may benefit from platinum-containing treatments.
17961161 Patients with ERCC1-negative tumors appear to have significantly better response to platinum-based chemotherapy compared to patients with ERCC1-positive tumors;the TT genotype seems to be favorable toward better response to platinum-based chemotherapy.
17961161 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17932351 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17925548 Observational study of gene-disease association. (HuGE Navigator)
17912758 The XPF HhH homodimer has a larger interaction interface, aromatic stacking interactions, and additional hydrogen bond contacts as compared to the XPF/ERCC1 HhH complex, which accounts for its higher stability
17720715 Identification of two distinct interaction surfaces of ERCC1 that mediate XPA and DNA binding.
17685459 Observational study of gene-disease association. (HuGE Navigator)
17617021 Observational study of gene-disease association. (HuGE Navigator)
17606717 ERCC1 has a role in head and neck squamous cell carcinomaresponse to Cisplatin-based induction chemotherapy
17549067 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17534174 the benefit of adjuvant cisplatin-based chemotherapy was more profound in patients with low ERCC1 expression.
17522621 Meta-analysis of gene-disease association. (HuGE Navigator)
17522621 meta-analysis suggests that the ERCC1 C8092A and T19007C polymorphisms had no association to cancer risk
17502833 Observational study of gene-disease association. (HuGE Navigator)
17502833 variant genotypes of the rs3212948 C allele were associated with significantly decreased risk of lung cancer
17438655 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17401013 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17314486 Observational study of gene-disease association. (HuGE Navigator)
17314486 Our findings suggest that the C19007T ERCC1 polymorphism is unlikely to play an important role in epithelial ovarian or endometrial cancer in Korean women.
17313739 Observational study of gene-disease association. (HuGE Navigator)
17303907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17299578 Meta-analysis of gene-disease association. (HuGE Navigator)
17273966 ERCC1 deficiency is associated with cerebro-oculo-facio-skeletal syndrome with a mild defect in nucleotide excision repair and severe developmental failure
17229776 results of the study indicate that ERCC1 may predict survival in bladder cancer treated by platinum-based therapy
17222938 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17210993 Observational study of gene-disease association. (HuGE Navigator)
17197435 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17151930 data indicated that ERCC1 mRNA level is associated with CDDP, BCNU & VCR cytotoxicity, while ERCC2 expression is associated with BCNU cytotoxicity in gliomas; however, there was no association between ERCC1, ERCC2 SNP and chemotherapy drug response
17131345 Observational study of gene-disease association. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17064812 ERCC1 expression may results in chemoresistance.
16985021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16979838 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16899630 The conflicting information regarding the ERCC1 codon 118 polymorphism might be explained by the coexistence of major confounding factors(smoking or diet), which might mask the relatively minor gene effect associated with a single genetic polymorphism.
16896002 Observational study of gene-disease association. (HuGE Navigator)
16875718 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16819291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16817948 Observational study of gene-disease association. (HuGE Navigator)
16723154 These results suggest that the ERCC1 8092C>A polymorphism may be related to the occurrence of childhood ALL in a Chinese population.
16690207 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16622263 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16609022 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16510122 Observational study of gene-disease association. (HuGE Navigator)
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16407418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16393248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16364765 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16351803 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16341770 Low variant A-allele frequency of ERCC1 G19007A in the Chinese population may suggest that the genetic contribution to cancer risk differs substantially between ethnic groups.
16338413 The ERCC1 domain folds properly only in the presence of the XPF domain, which implies a role for XPF as a scaffold for the folding of ERCC1.
16315315 The half-life of ERCC1 protein in a testis tumor cell line was not significantly different to that in a prostate cancer cell line. These results suggest that constitutive levels of these DNA repair proteins are controlled at the level of translation.
16308313 Observational study of gene-disease association. (HuGE Navigator)
16284380 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16284373 Observational study of gene-disease association. (HuGE Navigator)
16224397 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16212814 Observational study of gene-disease association. (HuGE Navigator)
16195237 Observational study of gene-disease association. (HuGE Navigator)
16144923 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16076955 XPF-ERCC1 recognizes a branched DNA substrate by binding the two ssDNA arms with the two HhH2 domains of XPF and ERCC1 and by binding the 5'-ssDNA arm with the central domain of ERCC1.
16034668 A nuclear magnetic resonance examination of the DNA binding site.
15958648 Observational study of gene-disease association. (HuGE Navigator)
15936590 Observational study of gene-disease association. (HuGE Navigator)
15932882 The XPF binding sites of ERCC1 were located in helices H1 and H3 and in the C-terminal region, similar to the involved surface of XPF.
15922480 Overexpression of ERCC1 is associated with liver fibrogenesis and cancer and could be related to the well recognized resistance of HCC to chemotherapeutics.
15885892 Observational study of gene-disease association. (HuGE Navigator)
15849729 Observational study of gene-disease association. (HuGE Navigator)
15788669 High ERCC1 gene expression is associated with chemotherapy resistance in esophageal cancer
15746057 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15746040 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15734977 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15709194 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15688021 This alternate transcript is ubiquitous in human tissues and cancer cell lines, but is absent in mouse and thus does not appear to be cancer related.
15297394 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15297394 the ERCC1 C8092A polymorphism may have a role in progression of non-small cell lung cancer
15277258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15213713 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15173087 ERCC1 has a role as a nucleotide excision repair protein involved in the repair of therapeutic radiation-induced DNA damage
15140544 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15095299 XPA, ERCC1 and XPF DNA repair protein expression is reduced in testis neoplasms
14734547 the ternary complex of hRad52 and XPF/ERCC1 is the active species that processes recombination intermediates generated during the repair of DNA double strand breaks and in homology-dependent gene targeting events.
14690602 Data reveal an unanticipated involvement of the ERCC1/XPF NER endonuclease in the regulation of telomere integrity.
12869411 Observational study of gene-disease association. (HuGE Navigator)
12865926 Observational study of gene-disease association. (HuGE Navigator)
12800797 ERCC1 gene is a useful independent prognostic tumor marker in patients with early stage non-small-cell lung cancer.
12645871 The results show a significant association between BCC and the A-allele of a polymorphism in ERCCI exon4 (Odds ratio 12;95% Confidence Interval 1.17-124; p(chi2, two-side) = 0.019) and to a lesser extent with XPD exon6 (p = 0.06).
12643788 Epidermal growth factor and ionizing radiation up-regulate the DNA repair genes XRCC1 and ERCC1 in DU145 and LNCaP prostate carcinoma through MAPK signaling.
12220217 Observational study of gene-disease association. (HuGE Navigator)
12189194 Inter-individual variation, seasonal variation and close correlation of OGG1 and ERCC1 mRNA levels in full blood
12164325 Observational study of genotype prevalence. (HuGE Navigator)
11936875 Lactacystin enhances cisplatin sensitivity in resistant human ovarian cancer cell lines via inhibition of DNA repair and ERCC-1 expression.
11062157 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLE      1 - 70
GAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALF     71 - 140
LSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE    141 - 210
TYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQ    211 - 280
KARRLFDVLHEPFLKVP                                                         281 - 297
//

Text Mined References (555)

PMID Year Title
27057082 2016 A Significant Statistical Advancement on the Predictive Values of ERCC1 Polymorphisms for Clinical Outcomes of Platinum-Based Chemotherapy in Non-Small Cell Lung Cancer: An Updated Meta-Analysis.
26939044 2016 New design of nucleotide excision repair (NER) inhibitors for combination cancer therapy.
26905109 Is there relationship between excision repair cross-complementation 1 expression level and response to treatment and prognosis in an advanced stage lung cancer treated with cisplatin-based chemotherapy?
26823845 2015 Prognostic value of ERCC1 and ERCC2 gene polymorphisms in patients with gastric cancer receiving platinum-based chemotherapy.
26805762 2016 Mitotic regulator Nlp interacts with XPA/ERCC1 complexes and regulates nucleotide excision repair (NER) in response to UV radiation.
26782397 2015 Genetic variability of ERCC1 and ERCC2 influences treatment outcomes in gastric cancer.
26722542 2015 Genetic variability of ERCC1 genes in NER pathway influences the treatment outcome of gastric cancer.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26662383 2015 Correlation of ERCC1 expression in peripheral blood lymphocytes with outcomes of patients with gastric cancer treated with oxaliplatin-based adjuvant chemotherapy.
26415382 2015 [ERCC1 as a Marker of Ovarian Cancer Resistance to Platinum Drugs].
26400354 2015 Investigation of ERCC1 and ERCC2 gene polymorphisms and response to chemotherapy and overall survival in osteosarcoma.
26372896 2015 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study.
26345951 2015 Association between ERCC1 and ERCC2 gene polymorphisms and chemotherapy response and overall survival in osteosarcoma.
26339355 2015 Genetic polymorphisms in nucleotide excision repair pathway influences response to chemotherapy and overall survival in osteosarcoma.
26336131 2015 Inhibition of DNA-repair genes Ercc1 and Mgmt enhances temozolomide efficacy in gliomas treatment: a pre-clinical study.
26253951 2015 Use a survival model to correlate single-nucleotide polymorphisms of DNA repair genes with radiation dose-response in patients with non-small cell lung cancer.
26200905 2015 Predictive and Prognostic Value of Ribonucleotide Reductase Regulatory Subunit M1 and Excision Repair Cross-Complementation Group 1 in Advanced Urothelial Carcinoma (UC) Treated with First-Line Gemcitabine Plus Platinum Combination Chemotherapy.
26191265 2015 Genetic variability of genes in NER pathway influences the treatment outcome of gastric cancer.
26165688 2015 Expression of ERCC1 and TUBB3 in locally advanced cervical squamous cell cancer and its correlation with different therapeutic regimens.
26162296 2015 ERCC1 as a Prognostic and Predictive Biomarker for Urothelial Carcinoma of the Bladder following Radical Cystectomy.
26125934 2015 Correlation of UGT1A1 and ERCC1 gene polymorphisms with the outcome of combined irinotecan plus cisplatin treatment in recurrent ovarian cancer.
26125779 2015 Correlation between ERCC1 expression and concurrent chemotherapy and radiotherapy in patients with locally advanced nasopharyngeal cancer.
26085086 2015 The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
26083491 2015 ERCC1 and TS Expression as Prognostic and Predictive Biomarkers in Metastatic Colon Cancer.
26074087 2015 The ERCC1 and ERCC4 (XPF) genes and gene products.
26066774 2015 Predictive Role of ERCC1 Expression in Head and Neck Squamous Cell Carcinoma Patients Treated with Surgery and Adjuvant Cisplatin-Based Chemoradiation.
26056042 2015 Functional intronic ERCC1 polymorphism from regulomeDB can predict survival in lung cancer after surgery.
26045829 2015 Polymorphisms in ERCC1 and XPF gene and response to chemotherapy and overall survival of non-small cell lung cancer.
26025908 2015 Repair synthesis step involving ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex.
26022132 2015 Association of ERCC1 polymorphisms (rs3212986 and rs11615) with the risk of head and neck carcinomas based on case-control studies.
26001533 2015 Polymorphisms in ERCC1 and ERCC2/XPD genes and carcinogen DNA adducts in human lung.
25973722 2015 The role of conformational selection in the molecular recognition of the wild type and mutants XPA67-80 peptides by ERCC1.
25965418 2015 A functional single-nucleotide polymorphism in the ERCC1 gene alters the efficacy of narrowband ultraviolet B therapy in patients with active vitiligo in a Chinese population.
25961110 2015 DNA repair genes XRCC1 and ERCC1 polymorphisms and the risk of sporadic breast cancer in Han women in the Gansu Province of China.
25946469 2015 Clinical utility of plasma Epstein-Barr virus DNA and ERCC1 single nucleotide polymorphism in nasopharyngeal carcinoma.
25941922 2015 Lentivirus-Mediated RNAi silencing targeting ERCC1 reverses cisplatin resistance in cisplatin-resistant ovarian carcinoma cell line.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25867436 2015 Systematic review on the association between ERCC1 rs3212986 and ERCC2 rs13181 polymorphisms and glioma risk.
25840756 2015 Importance of excision repair cross-complementation group 1 and ribonucleotide reductase M1 as prognostic biomarkers in malignant pleural mesothelioma treated with platinum-based induction chemotherapy followed by surgery.
25754170 2015 ERCC1 plays an important role in predicting survival outcomes and treatment response for patients with HNSCC: a meta-analysis.
25730007 2015 Association between ERCC1 and XPF polymorphisms and risk of colorectal cancer.
25690281 2015 XRCC1 and ERCC1 polymorphisms are related to susceptibility and survival of colorectal cancer in the Chinese population.
25684513 2015 DNA repair gene polymorphisms do not predict response to radiotherapy-based multimodality treatment of patients with rectal cancer: a meta-analysis.
25674197 2014 Prognostic value of ERCC1 mRNA expression in non-small cell lung cancer, breast cancer, and gastric cancer in patients from Southern China.
25647444 2015 ERCC1 SNPs as Potential Predictive Biomarkers in Non-Small Cell Lung Cancer Patients Treated With Platinum-Based Chemotherapy.
25600168 2015 Excision repair cross-complementation group 1 protein expression predicts survival in patients with high-grade, non-metastatic osteosarcoma treated with neoadjuvant chemotherapy.
25596702 2015 Prognostic value of ERCC1, ERCC2, XRCC1, and TP53 single nucleotide polymorphisms in patients with early-stage non-small cell lung cancer.
25560468 2015 Predicting chemosensitivity to gemcitabine and cisplatin based on gene polymorphisms and mRNA expression in non-small-cell lung cancer cells.
25542228 2015 Genetic polymorphisms of DNA repair pathways influence the response to chemotherapy and overall survival of gastric cancer.
25538220 2015 USP45 deubiquitylase controls ERCC1-XPF endonuclease-mediated DNA damage responses.
25533188 2015 The SLX4 complex is a SUMO E3 ligase that impacts on replication stress outcome and genome stability.
25501233 2014 ERCC1 mRNA expression is associated with the clinical outcome of non-small cell lung cancer treated with platinum-based chemotherapy.
25495407 2014 SNPs and taxane toxicity in breast cancer patients.
25434755 2015 Excision repair cross complementation group 1 is a chemotherapy-tolerating gene in cisplatin-based treatment for non-small cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25375151 2014 The prognostic value of excision repair cross-complementation group 1 (ERCC1) in patients with small cell lung cancer (SCLC) receiving platinum-based chemotherapy: evidence from meta-analysis.
25366790 2014 Effect of ERCC1 polymorphism on the response to chemotherapy and clinical outcome of non-small cell lung cancer.
25366763 2014 Study on the ERCC1 gene polymorphism response to chemotherapy and prognosis of gastric cancer.
25339033 2014 The ERCC1 C118T polymorphism predicts clinical outcomes of colorectal cancer patients receiving oxaliplatin-based chemotherapy: a meta-analysis based on 22 studies.
25253066 2014 ERCC1 polymorphisms as prognostic markers in T4 breast cancer patients treated with platinum-based chemotherapy.
25250341 2014 Multiple analytical approaches demonstrate a complex relationship of genetic and nongenetic factors with cisplatin- and carboplatin-induced nephrotoxicity in lung cancer patients.
25246386 2014 Correlation between TS, MTHFR, and ERCC1 gene polymorphisms and the efficacy of platinum in combination with pemetrexed first-line chemotherapy in mesothelioma patients.
25227663 2014 Prognostic significance of BRCA1, ERCC1, RRM1, and RRM2 in patients with advanced non-small cell lung cancer receiving chemotherapy.
25217323 2014 ERCC1 and the efficacy of cisplatin in patients with resected non-small cell lung cancer.
25192052 2014 Alterations of the RRAS and ERCC1 genes at 19q13 in gemistocytic astrocytomas.
25191856 2014 ERCC1 single nucleotide polymorphism C8092A, but not its expression is associated with survival of esophageal squamous cell carcinoma patients from Fujian province, China.
25155628 2014 Frequency distribution of DNA repair genes ERCC1 and ERCC2 polymorphisms in South Indian healthy population.
25107571 2014 Predictive value of APE1, BRCA1, ERCC1 and TUBB3 expression in patients with advanced non-small cell lung cancer (NSCLC) receiving first-line platinum-paclitaxel chemotherapy.
25076246 Low expression of excision repair cross-complementation group-1 protein predicts better outcome in patients with locally advanced nasopharyngeal cancer treated with concurrent chemoradiotherapy.
25051148 2014 Nucleotide excision repair gene ERCC1 19007T>C polymorphism contributes to lung cancer susceptibility: a meta-analysis.
25042384 2014 ERCC1 expression and tumor regression predict survival in esophageal squamous cell carcinoma patients receiving combined trimodality therapy.
25028118 2014 Polymorphisms in TS, MTHFR and ERCC1 genes as predictive markers in first-line platinum and pemetrexed therapy in NSCLC patients.
25025378 2014 ERCC1 Cys8092Ala and XRCC1 Arg399Gln polymorphisms predict progression-free survival after curative radiotherapy for nasopharyngeal carcinoma.
24994039 2014 Predictive value of excision repair cross-complementation group 1 expression for platinum-based chemotherapy and survival in gastric cancer: a meta-analysis.
24958519 2014 Genetic polymorphism of GSTP1 and ERCC1 correlated with response to platinum-based chemotherapy in non-small cell lung cancer.
24935625 2014 Prognostic and predictive role of ERCC1 protein expression in locally advanced stage III non-small cell lung cancer.
24935356 2014 ERCC1 as a biological marker guiding management in malignant pleural mesothelioma.
24870596 2014 The prognostic value of ERCC1 expression in gastric cancer patients treated with platinum-based chemotherapy: a meta-analysis.
24861646 2014 Association of single nucleotide polymorphisms of ERCC1 and XPF with colorectal cancer risk and interaction with tobacco use.
24859833 2014 Polymorphisms in ERCC1 gene could predict clinical outcome of platinum-based chemotherapy for non-small cell lung cancer patients.
24854656 2014 Expression of ERCC1 and BRCA1 predict the clinical outcome of non-small cell lung cancer in patients receiving platinum-based chemotherapy.
24841208 2014 Association studies of ERCC1 polymorphisms with lung cancer susceptibility: a systematic review and meta-analysis.
24833529 2012 ERCC1 and XPD/ERCC2 polymorphisms' predictive value of oxaliplatin-based chemotherapies in advanced colorectal cancer has an ethnic discrepancy: a meta-analysis.
24817012 2014 Cell cycle association and hypoxia regulation of excision repair cross complementation group 1 protein (ERCC1) in tumor cells of head and neck cancer.
24793015 2014 Association of DNA repair gene polymorphisms with response to chemotherapy and prognosis of gastric cancer in a Chinese population.
24782032 2014 Association of single-nucleotide polymorphisms in ERCC1 and ERCC2 with glioma risk.
24780295 2014 Importance of EGFR/ERCC1 interaction following radiation-induced DNA damage.
24763305 2014 Association of ERCC1 C8092A and ERCC2 Lys751Gln polymorphisms with the risk of glioma: a meta-analysis.
24762590 2014 Gene expression profiles of ERCC1, TYMS, RRM1, TUBB3 and EGFR in tumor tissue from non-small cell lung cancer patients.
24761869 2014 Expression of ERCC1, MSH2 and PARP1 in non-small cell lung cancer and prognostic value in patients treated with platinum-based chemotherapy.
24737474 2014 Genetic variation in ERCC1 and XPF genes and breast cancer risk.
24699918 2014 ERCC1 siRNA ameliorates drug resistance to cisplatin in gastric carcinoma cell lines.
24662920 2014 ATR pathway inhibition is synthetically lethal in cancer cells with ERCC1 deficiency.
24585004 2014 Resistance to first line platinum paclitaxel chemotherapy in serous epithelial ovarian cancer: the prediction value of ERCC1 and Tau expression.
24563277 2014 Association of single nucleotide polymorphisms of nucleotide excision repair genes with laryngeal cancer risk and interaction with cigarette smoking and alcohol drinking.
24532427 2014 Genetic association of CHEK2, GSTP1, and ERCC1 with glioblastoma in the Han Chinese population.
24531312 2014 Association of ERCC1 and ERCC2 polymorphisms with colorectal cancer risk in a Chinese population.
24499239 2014 Predicting the outcome of platinum-based chemotherapies in epithelial ovarian cancer using the 8092C/A polymorphism of ERCC1: a meta-analysis.
24460276 2013 Meta-analysis of excision repair cross-complementation group 1 (ERCC1) association with response to platinum- based chemotherapy in ovarian cancer.
24453030 2014 DNA repair gene ERCC1 polymorphisms may contribute to the risk of glioma.
24443257 2014 ERCC1 and BRCA1 mRNA expressions are associated with clinical outcome of non-small cell lung cancer treated with platinum-based chemotherapy.
24403494 2014 ERCC1 expression as a predictive marker of cervical cancer treated with cisplatin-based chemoradiation.
24403493 2014 ERCC1 expression as a predictor of resistance to platinum-based chemotherapy in primary ovarian cancer.
24403450 2014 ERCC1 expression and chemosensitivity in uterine cervical adenocarcinoma cells.
24370899 2014 Role of ERCC1 variants in response to chemotherapy and clinical outcome of advanced non-small cell lung cancer.
24340057 2013 Genetic variations in radiation and chemotherapy drug action pathways and survival in locoregionally advanced nasopharyngeal carcinoma treated with chemoradiotherapy.
24338713 2014 The association between the ERCC1/2 polymorphisms and the clinical outcomes of the platinum-based chemotherapy in non-small cell lung cancer (NSCLC): a systematic review and meta-analysis.
24326865 2014 ERCC1 in advanced biliary tract cancer patients treated with chemotherapy: prognostic and predictive roles.
24318989 2014 Influence of ERCC1 and ERCC4 polymorphisms on response to prognosis in gastric cancer treated with FOLFOX-based chemotherapy.
24254311 2014 Association between ERCC1 C8092A and ERCC2 K751Q polymorphisms and risk of adult glioma: a meta-analysis.
24220697 2014 Excision Repair Cross-Complementation group 1 (ERCC1) C118T SNP does not affect cellular response to oxaliplatin.
24175850 2013 DNA repair capacity in peripheral blood lymphocytes predicts efficacy of platinum-based chemotherapy in patients with gastric cancer.
24158589 2014 Molecular docking and molecular dynamics study on the effect of ERCC1 deleterious polymorphisms in ERCC1-XPF heterodimer.
24144331 2013 An explorative analysis of ERCC1-19q13 copy number aberrations in a chemonaive stage III colorectal cancer cohort.
24140460 2013 HapMap-based study identifies risk sub-region on chromosome 19q13.3 in relation to lung cancer among Chinese.
24135250 2013 Association between clinical pathology and multiple genes mRNA expression in Chinese patients with NSCLC.
24125975 Excision repair cross-complementation group 1 codon 118 polymorphism, micro ribonucleic acid and protein expression, clinical outcome of the advanced gastric cancer response to first-line FOLFOX-4 in Qinghai-Tibetan plateau population.
24088734 2013 Quantification of excision repair cross-complementing group 1 and survival in p16-negative squamous cell head and neck cancers.
24045016 2013 Phase II trial of customized first line chemotherapy according to ERCC1 and RRM1 SNPs in patients with advanced non-small-cell lung cancer.
24036546 2013 ERCC1 function in nuclear excision and interstrand crosslink repair pathways is mediated exclusively by the ERCC1-202 isoform.
24023723 2013 ERCC1 and ERCC2 variants predict survival in gastric cancer patients.
23996617 2013 Predictive value of ERCC1, ERCC2, and XRCC1 overexpression for stage III colorectal cancer patients receiving FOLFOX-4 adjuvant chemotherapy.
23993732 2013 Excision-repair-cross-complement-1 protein as a prognostic factor in patients with advanced non-small cell lung cancer treated with platinum-based first-line chemotherapy.
23982883 2014 XPF protein levels determine sensitivity of malignant melanoma cells to oxaliplatin chemotherapy: suitability as a biomarker for patient selection.
23982437 2013 Predictive value of ERCC1 and RRM1 gene single-nucleotide polymorphisms for first-line platinum- and gemcitabine-based chemotherapy in non-small cell lung cancer patients.
23948418 2013 [Differential expressions of MDR-1, RRM-1, EGFR and ERCC-1 in primary tumors and metastatic lymph nodes of NSCLC patients].
23940741 2013 Prognostic value of EGFR mutation and ERCC1 in patients with non-small cell lung cancer undergoing platinum-based chemotherapy.
23912706 2013 Pemetrexed downregulates ERCC1 expression and enhances cytotoxicity effected by resveratrol in human nonsmall cell lung cancer cells.
23909490 2013 Polymorphisms in the ERCC1 and XPF genes and risk of breast cancer in a Chinese population.
23884439 2013 Impact of excision repair cross-complementing gene 1 (ERCC1) on the outcomes of patients with advanced gastric cancer: correlative study in Japan Clinical Oncology Group Trial JCOG9912.
23846458 2013 ERCC1 protein expression is associated with differential survival in oropharyngeal head and neck squamous cell carcinoma.
23817665 2013 ?-Elemene enhances susceptibility to cisplatin in resistant ovarian carcinoma cells via downregulation of ERCC-1 and XIAP and inactivation of JNK.
23810210 2013 ERCC1, MLH1, MSH2, MSH6, and ?III-tubulin: resistance proteins associated with response and outcome to platinum-based chemotherapy in malignant pleural mesothelioma.
23807173 2013 Association between ERCC1 and XPA expression and polymorphisms and the response to cisplatin in testicular germ cell tumours.
23773262 2013 19q13-ERCC1 gene copy number increase in non--small-cell lung cancer.
23759026 2013 Prognostic potential of ERCC1 protein expression and clinicopathologic factors in stage III/N2 non-small cell lung cancer.
23746523 2013 Conformational determinants for the recruitment of ERCC1 by XPA in the nucleotide excision repair (NER) Pathway: structure and dynamics of the XPA binding motif.
23727606 2013 Association of ERCC1-C118T and -C8092A polymorphisms with lung cancer risk and survival of advanced-stage non-small cell lung cancer patients receiving platinum-based chemotherapy: a pooled analysis based on 39 reports.
23719746 2013 Differential expression and prognostic value of ERCC1 and thymidylate synthase in resected gastric adenocarcinoma.
23712330 2013 Polymorphisms in ERCC1 C8092A predict progression-free survival in metastatic/recurrent nasopharyngeal carcinoma treated with cisplatin-based chemotherapy.
23702380 2013 Clinicopathological significance of ERCC1 expression in breast cancer.
23684781 2013 Phase II study of satraplatin and prednisone in patients with metastatic castration-resistant prostate cancer: a pharmacogenetic assessment of outcome and toxicity.
23674849 2013 Emodin regulating excision repair cross-complementation group 1 through fibroblast growth factor receptor 2 signaling.
23632208 2013 The role of single nucleotide polymorphisms of the ERCC1 and MMS19 genes in predicting platinum-sensitivity, progression-free and overall survival in advanced epithelial ovarian cancer.
23623389 2013 Malfunction of nuclease ERCC1-XPF results in diverse clinical manifestations and causes Cockayne syndrome, xeroderma pigmentosum, and Fanconi anemia.
23593158 2013 ERCC1 and ERCC2 haplotype modulates induced BPDE-DNA adducts in primary cultured lymphocytes.
23581229 2012 The relationship between EGFR gene mutation status and ERCC1 in lung adenocarcinoma of Chinese patients receiving platinum-based neoadjuvant chemotherapy.
23580445 2013 Small molecule inhibitors of ERCC1-XPF protein-protein interaction synergize alkylating agents in cancer cells.
23549037 2013 ERCC1/BRCA1 expression and gene polymorphisms as prognostic and predictive factors in advanced NSCLC treated with or without cisplatin.
23523421 2013 Thymidylate synthase and ERCC1 as predictive markers in patients with pulmonary adenocarcinoma treated with pemetrexed and cisplatin.
23514287 2013 ERCC1 isoform expression and DNA repair in non-small-cell lung cancer.
23496813 2013 BRCA1 and ERCC1 mRNA levels are associated with lymph node metastasis in Chinese patients with colorectal cancer.
23481186 2013 ERCC1, defective mismatch repair status as predictive biomarkers of survival for stage III colon cancer patients receiving oxaliplatin-based adjuvant chemotherapy.
23435956 2013 Decreased expression of DNA repair genes (XRCC1, ERCC1, ERCC2, and ERCC4) in squamous intraepithelial lesion and invasive squamous cell carcinoma of the cervix.
23401439 2013 ERCC1 and RRM1: ready for prime time?
23275151 2013 PARP inhibition selectively increases sensitivity to cisplatin in ERCC1-low non-small cell lung cancer cells.
23272099 2012 Virtual screening and biological evaluation of inhibitors targeting the XPA-ERCC1 interaction.
23263828 2013 A phase II study of biweekly paclitaxel and cisplatin chemotherapy for recurrent or metastatic esophageal squamous cell carcinoma: ERCC1 expression predicts response to chemotherapy.
23259415 2012 ERCC1 mRNA levels can predict the response to cisplatin-based concurrent chemoradiotherapy of locally advanced cervical squamous cell carcinoma.
23244079 2012 Comprehensive study on associations between nine SNPs and glioma risk.
23203453 2013 Excision repair of BPDE-adducts in human lymphocytes: diminished capacity associated with ERCC1 C8092A (rs3212986) polymorphism.
23171216 2012 Using protein microarray technology to screen anti-ERCC1 monoclonal antibodies for specificity and applications in pathology.
23166636 2012 Polymorphisms in ERCC1 and XPF genes and risk of gastric cancer in an eastern Chinese population.
23155271 2012 Prognostic significance of ERCC1, RRM1 and BRCA1 in surgically-treated patients with non-small cell lung cancer.
23148636 2012 Association of ERCC1 SNPs with outcome in platinum-treated patients with advanced urothelial cancer: a Hellenic Cooperative Oncology Group study.
23147699 2013 Association of genetic polymorphisms in ERCC1 and ERCC2/XPD with risk of chronic benzene poisoning in a Chinese occupational population.
23147544 2012 RASSF1A and ERCC1 expression levels might be predictive of prognosis in advanced, recurrent, and metastatic squamous cell carcinoma of the head and neck treated with docetaxel and cisplatin.
23098477 2012 Association of four ERCC1 and ERCC2 SNPs with survival of bone tumour patients.
23095216 2012 Evaluation of cell proliferation, apoptosis, and DNA-repair genes as potential biomarkers for ethanol-induced CNS alterations.
23086647 2012 [Expression of RRM1 and ERCC1 genes in tumor tissues and peripheral blood lymphocytes of advanced non-small cell lung cancer].
23011763 2013 Prognostic value of ERCC1 in head and neck carcinoma treated with definitive or adjuvant radiotherapy.
22994779 2012 GSTP1, ERCC1 and ERCC2 polymorphisms, expression and clinical outcome of oxaliplatin-based adjuvant chemotherapy in colorectal cancer in Chinese population.
22938460 2012 DNA repair gene ERCC1 and XPD polymorphisms predict glioma susceptibility and prognosis.
22932088 2012 A meta-analytic review of ERCC1/MDR1 polymorphism and chemosensitivity to platinum in patients with advanced non-small cell lung cancer.
22897321 2012 ERCC1 C19007T polymorphism and the risk and invasiveness of cervical cancer in Korean women.
22890830 2012 Differential expression of ERCC-1 in the primary tumors and metastatic lymph nodes of patients with non-small cell lung cancer adenocarcinoma.
22863869 2013 Low ERCC1 expression is associated with prolonged survival in patients with bladder cancer receiving platinum-based neoadjuvant chemotherapy.
22821389 2012 Polymorphisms of ERCC1 genotype associated with response to imatinib therapy in chronic phase chronic myeloid leukemia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22740205 ERCC1 expression in triple negative breast cancer.
22609620 2012 Comparison of ERCC1/XPF genetic variation, mRNA and protein levels in women with advanced stage ovarian cancer treated with intraperitoneal platinum.
22571922 2012 Expression of ERCC1 predicts clinical outcome in locoregionally advanced nasopharyngeal carcinoma treated with cisplatin-based induction chemotherapy.
22569992 2013 An analysis of human equilibrative nucleoside transporter-1, ribonucleoside reductase subunit M1, ribonucleoside reductase subunit M2, and excision repair cross-complementing gene-1 expression in patients with resected pancreas adenocarcinoma: implications for adjuvant treatment.
22555222 2012 ERCC1 expression in circulating tumor cells (CTCs) using a novel detection platform correlates with progression-free survival (PFS) in patients with metastatic non-small-cell lung cancer (NSCLC) receiving platinum chemotherapy.
22547097 2012 Multiple DNA binding domains mediate the function of the ERCC1-XPF protein in nucleotide excision repair.
22457069 2012 Fluorescence-based incision assay for human XPF-ERCC1 activity identifies important elements of DNA junction recognition.
22439756 2012 Combined analysis of mRNA expression of ERCC1, BAG-1, BRCA1, RRM1 and TUBB3 to predict prognosis in patients with non-small cell lung cancer who received adjuvant chemotherapy.
22374244 2012 ERCC1 gene +262A/C polymorphism associated with risk of gastric cardiac adenocarcinoma in nonsmokers.
22351191 2012 Hapmap-based evaluation of ERCC2, PPP1R13L, and ERCC1 and lung cancer risk in a Chinese population.
22344449 2012 ERCC1 and topoisomerase I expression in small cell lung cancer: prognostic and predictive implications.
22331726 Expression of ERCC1 protein in biopsy specimen predicts survival in advanced ovarian cancer patients treated with platinum-based chemotherapy.
22329723 2012 Association between polymorphisms of ERCC1 and survival in epithelial ovarian cancer patients with chemotherapy.
22302397 2012 ERCC1 expression as a prognostic and predictive factor in patients with non-small cell lung cancer: a meta-analysis.
22266871 2012 Inhibition of Gli1 results in altered c-Jun activation, inhibition of cisplatin-induced upregulation of ERCC1, XPD and XRCC1, and inhibition of platinum-DNA adduct repair.
22261301 2012 Pre-treatment tumor expression of ERCC1 in women with advanced stage epithelial ovarian cancer is not predictive of clinical outcomes: a Gynecologic Oncology Group study.
22212909 2012 Deficiency of DNA repair nuclease ERCC1-XPF promotes prostate cancer progression in a tissue recombination model.
22203729 2012 Treatment-related protein biomarker expression differs between primary and recurrent ovarian carcinomas.
22201261 2012 ERCC1 polymorphisms and risk of adult glioma in a Chinese population: a hospital-based case-control study.
22199271 2011 ERCC1 expression and outcomes in head and neck cancer treated with concurrent cisplatin and radiation.
22177891 2012 The prognostic value of histological typing in nasopharyngeal carcinoma.
22176134 2012 DNA repair gene excision repair cross complementing-group 1 (ERCC1) in head and neck squamous cell carcinoma: analysis of methylation and polymorphism (G19007A), protein expression and association with epidemiological and clinicopathological factors.
22159227 2012 Activation of a Tip60/E2F1/ERCC1 network in human lung adenocarcinoma cells exposed to cisplatin.
22110208 2011 Relationship between TYMS and ERCC1 mRNA expression and in vitro chemosensitivity in colorectal cancer.
22102173 2012 A C118T polymorphism of ERCC1 and response to cisplatin chemotherapy in patients with late-stage non-small cell lung cancer.
22093627 2011 [EGFR gene copy number, ERCC1 and BRCA1 protein expression and their relationship in non-small cell lung cancer].
22053010 2012 Inhibition of p38 MAPK-dependent excision repair cross-complementing 1 expression decreases the DNA repair capacity to sensitize lung cancer cells to etoposide.
22034895 2011 Excision repair cross-complementation group 1 expression predicts response and survival in locally advanced cervical carcinoma patients treated with concurrent chemoradiotherapy.
22022380 2011 Excision repair cross-complementation group 1 (ERCC1) status and lung cancer outcomes: a meta-analysis of published studies and recommendations.
22002622 2012 Nucleotide excision repair gene ERCC1 polymorphisms contribute to cancer susceptibility: a meta-analysis.
21971700 2012 Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer.
21956434 2012 Neoadjuvant radiochemotherapy in adenocarcinoma of the esophagus: ERCC1 gene polymorphisms for prediction of response and prognosis.
21942242 2012 Association of GSTT1 polymorphism with acute myeloid leukemia risk is dependent on smoking status.
21940361 Predictive value of expression of ERCC 1 and GST-p for 5-fluorouracil/oxaliplatin chemotherapy in advanced colorectal cancer.
21933627 2011 Excision repair cross complementation group 1 polymorphisms and lung cancer risk: a meta-analysis.
21902499 2011 Pharmacogenetic analyses of cisplatin-induced nephrotoxicity indicate a renoprotective effect of ERCC1 polymorphisms.
21899657 2012 Disease-free survival of patients after surgical resection of non-small cell lung carcinoma and correlation with excision repair cross-complementation group 1 expression and genotype.
21896658 2011 Human SNM1A and XPF-ERCC1 collaborate to initiate DNA interstrand cross-link repair.
21875468 2011 [Expression of ERCC1 mRNA and its impact on the prognosis of patients with non-small cell lung cancer].
21839691 2011 The knock-down of ERCC1 but not of XPF causes multinucleation.
21827803 2011 Polymorphisms of ERCC1 C118T/C8092A and MDR1 C3435T predict outcome of platinum-based chemotherapies in advanced non-small cell lung cancer: a meta-analysis.
21788964 2012 TS and ERCC-1 mRNA expressions and clinical outcome in patients with metastatic colon cancer in CONFIRM-1 and -2 clinical trials.
21766907 2011 Role of DNA repair gene polymorphisms in the efficiency of platinum-based adjuvant chemotherapy for non-small cell lung cancer.
21750204 2011 Molecular Characteristics of ERCC1-Negative versus ERCC1-Positive Tumors in Resected NSCLC.
21726821 2011 Chemotherapy-induced neutropenia does not correlate with DNA repair gene polymorphisms and treatment efficacy in advanced non-small-cell lung cancer patients.
21720251 2011 The relationship between ERCC1 expression and clinical outcome in patients with FIGO stage I to stage II uterine cervical adenocarcinoma.
21601580 2011 HapMap-based study of a region encompassing ERCC1 and ERCC2 related to lung cancer susceptibility in a Chinese population.
21597406 2011 Prognostic significance of ERCC1 expression in resected non small cell lung carcinoma.
21553054 2012 Expression of ERCC1 and its clinicopathological correlations in non-small cell lung cancer.
21553053 2012 The determination of relationship between "excision repair cross-complementing group 1" (ERCC1) gene T19007C and C8092A single nucleotide polymorphisms and clinicopathological parameters in non-small cell lung cancer.
21529986 2011 Tubulin, BRCA1, ERCC1, Abraxas, RAP80 mRNA expression, p53/p21 immunohistochemistry and clinical outcome in patients with advanced non small-cell lung cancer receiving first-line platinum-gemcitabine chemotherapy.
21496891 2011 Single nucleotide polypmorphisms in ERCC1 are associated with disease progression, and survival in patients with advanced stage ovarian and primary peritoneal carcinoma; a Gynecologic Oncology Group study.
21450455 2011 Topoisomerase II-alpha protein expression and histological response following doxorubicin-based induction chemotherapy predict survival of locally advanced soft tissues sarcomas.
21426588 2011 High ERCC1 expression predicts cisplatin-based chemotherapy resistance and poor outcome in unresectable squamous cell carcinoma of head and neck in a betel-chewing area.
21418871 2011 [Predictive values of platinum-related gene polymorphisms in gastric cancer patients on oxaliplatin-based adjuvant chemotherapy].
21394302 2011 The expression of ERCC1, RRM1, and BRCA1 in breast cancer according to the immunohistochemical phenotypes.
21360249 2011 Differential expression of ERCC1 in pancreas adenocarcinoma: high tumor expression is associated with earlier recurrence and shortened survival after resection.
21355309 2011 [The protein expression of ERCC1 and survivin in epithelial ovarian carcinoma and their clinical significance].
21323960 2011 Immunohistochemical analysis of p53, APE1, hMSH2 and ERCC1 proteins in actinic cheilitis and lip squamous cell carcinoma.
21289518 2011 Expression of excision repair cross-complementation group 1, breast cancer susceptibility 1, and ? III-tubulin in thymic epithelial tumors.
21286668 2011 Genetic polymorphisms of ERCC1 and their effects on the efficacy of cisplatin-based chemotherapy in advanced esophageal carcinoma.
21278243 2011 ERCC1 and ERCC2 polymorphisms predict clinical outcomes of oxaliplatin-based chemotherapies in gastric and colorectal cancer: a systemic review and meta-analysis.
21262916 2011 Thymidylate synthase and excision repair cross-complementing group-1 as predictors of responsiveness in mesothelioma patients treated with pemetrexed/carboplatin.
21206986 2011 ERCC1 protein, mRNA expression and T19007C polymorphism as prognostic markers in head and neck squamous cell carcinoma patients treated with surgery and adjuvant cisplatin-based chemoradiation.
21177407 2011 Excision repair cross-complementing group 1 may predict the efficacy of chemoradiation therapy for muscle-invasive bladder cancer.
21165580 2011 Tanshinone IIA acts via p38 MAPK to induce apoptosis and the down-regulation of ERCC1 and lung-resistance protein in cisplatin-resistant ovarian cancer cells.
21117025 2011 ERCC1 (excision repair cross-complementing 1) expression in pT2 gallbladder cancer is a prognostic factor.
21093896 2011 ERCC1 (excision repair cross-complementation group 1) expression as a predictor for response of neoadjuvant chemotherapy for FIGO stage 2B uterine cervix cancer.
21091775 2010 Excision repair cross-complementation group 1 (ERCC1) expression in advanced urothelial carcinoma patients receiving cisplatin-based chemotherapy.
21076943 2011 Evaluation of ERCC1 expression for cisplatin sensitivity in human hepatocellular carcinoma.
21075476 2011 No evidence of an association of ERCC1 and ERCC2 polymorphisms with clinical outcomes of platinum-based chemotherapies in non-small cell lung cancer: a meta-analysis.
21057378 2011 Multiple genetic polymorphisms in the prediction of clinical outcome of metastatic colorectal cancer patients treated with first-line FOLFOX-4 chemotherapy.
21048041 2011 Pharmacogenetic interaction analysis for the efficacy of systemic treatment in metastatic colorectal cancer.
21029695 2010 [Association between genetic polymorphisms of ERCC1, XRCC1, GSTP1 and survival of advanced gastric cancer patients treated with oxaliplatin/5-Fu-based chemotherapy].
21029626 2010 [Correlation between expression of excision repair cross-complementing 1 and cisplatin sensitivity in non-small cell lung cancer].
20979931 2010 Associations between oxaliplatin-induced peripheral neuropathy and polymorphisms of the ERCC1 and GSTP1 genes.
20975603 2010 Association of epidermal growth factor receptor activating mutations with low ERCC1 gene expression in non-small cell lung cancer.
20957144 2010 Interactions between exposure to environmental polycyclic aromatic hydrocarbons and DNA repair gene polymorphisms on bulky DNA adducts in human sperm.
20935060 2010 Genetic modifiers of carcinogen DNA adducts in target lung and peripheral blood mononuclear cells.
20868593 2010 [Expression and predictive role of excision repair cross complementation group 1, ribonucleotide reductase subunit M1, and ?-tubulin 3 in postoperative patients with non-small cell lung cancer receiving adjuvant chemotherapy].
20864414 2010 Polymorphisms of nucleotide-excision repair genes may contribute to sperm DNA fragmentation and male infertility.
20863778 2011 Association studies of excision repair cross-complementation group 1 (ERCC1) haplotypes with lung and head and neck cancer risk in a Caucasian population.
20855270 2010 [ERCC1 expression and outcomes of neo-adjuvant chemotherapy in elderly patients with non-small cell lung cancer].
20846399 2010 Cisplatin sensitivity of testis tumour cells is due to deficiency in interstrand-crosslink repair and low ERCC1-XPF expression.
20823140 2010 Regulation of excision repair cross-complementation group 1 by Snail contributes to cisplatin resistance in head and neck cancer.
20817763 2010 Polymorphic DNA repair and metabolic genes: a multigenic study on gastric cancer.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20736746 2010 Detection of ERCC1 118 polymorphisms in non-small-cell lung cancer by an improved fluorescence polarization assay.
20734048 2011 Phase II study of biweekly S-1 and oxaliplatin combination chemotherapy in metastatic colorectal cancer and pharmacogenetic analysis.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20728204 2010 Excision repair cross-complementation group 1 protein overexpression as a predictor of poor survival for high-grade serous ovarian adenocarcinoma.
20689757 2010 MDR1 and ERCC1 expression predict outcome of patients with locally advanced bladder cancer receiving adjuvant chemotherapy.
20677561 2010 [Association between polymorphisms of ERCC1 and response in patients with advanced non-small cell lung cancer receiving cisplatin-based chemotherapy].
20673527 2010 [The clinical signifcance of expression of ERCC1 and PkCalpha in non-small cell lung cancer].
20673515 2010 [The expression and prognostic significance of ERCC1 and GST-pi in lung cancer].
20651406 2010 Increased ERCC1 protein expression is associated with suboptimal debulking in advanced epithelial ovarian cancer.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20627363 2011 Single nucleotide polymorphisms in MDR1 gen correlates with outcome in advanced non-small-cell lung cancer patients treated with cisplatin plus vinorelbine.
20530282 2010 Pharmacogenetic predictors of adverse events and response to chemotherapy in metastatic colorectal cancer: results from North American Gastrointestinal Intergroup Trial N9741.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20518486 2010 The Fanconi anemia protein, FANCG, binds to the ERCC1-XPF endonuclease via its tetratricopeptide repeats and the central domain of ERCC1.
20508946 2011 Nucleotide excision repair polymorphisms and survival outcome for patients with metastatic breast cancer.
20504250 2010 Pharmacogenetic analysis in neoadjuvant chemoradiation for rectal cancer: high incidence of somatic mutations and their relation with response.
20504223 2010 High-level mRNA of excision repair cross-complementation group 1 gene is associated with poor outcome of platinum-based doublet chemotherapy of advanced nonsmall cell lung cancer patients.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20495366 2010 Genetic polymorphisms in XRCC1 associated with radiation therapy in prostate cancer.
20470393 2010 Up-regulation of Fas reverses cisplatin resistance of human small cell lung cancer cells.
20467918 2011 ERCC1, RRM1 and BRCA1 mRNA expression levels and clinical outcome of advanced non-small cell lung cancer.
20462983 2010 Predictive effects of ERCC1 and XRCC3 SNP on efficacy of platinum-based chemotherapy in advanced NSCLC patients.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20429839 2010 Polymorphisms in DNA damage response genes and head and neck cancer risk.
20395129 2010 ERCC1, toxicity and quality of life in advanced NSCLC patients randomized in a large multicentre phase III trial.
20391138 2010 Lifestyle, environmental, and genetic predictors of bulky DNA adducts in a study population nested within a prospective Danish cohort.
20385995 2010 Pharmacogenetic assessment of toxicity and outcome in patients with metastatic colorectal cancer treated with LV5FU2, FOLFOX, and FOLFIRI: FFCD 2000-05.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20368715 2011 Tumor response is predicted by patient genetic profile in rectal cancer patients treated with neo-adjuvant chemo-radiotherapy.
20354815 2011 Genetic polymorphisms in ATM, ERCC1, APE1 and iASPP genes and lung cancer risk in a population of southeast China.
20351547 2010 Association between polymorphisms of ERCC1 and XPD and clinical response to platinum-based chemotherapy in advanced non-small cell lung cancer.
20332140 2010 ERCC1 and histopathology in advanced NSCLC patients randomized in a large multicenter phase III trial.
20331623 2010 BRCA1 and XRCC1 polymorphisms associated with survival in advanced gastric cancer treated with taxane and cisplatin.
20232390 2011 Genetic variations of DNA repair genes and their prognostic significance in patients with acute myeloid leukemia.
20221251 2010 Mislocalization of XPF-ERCC1 nuclease contributes to reduced DNA repair in XP-F patients.
20216541 2010 Oxaliplatin, irinotecan and capecitabine as first-line therapy in metastatic colorectal cancer (mCRC): a dose-finding study and pharmacogenomic analysis.
20211060 2010 [Expression of Gemcitabine-resistance-related gene and polymorphism of ribonucleotide reductase M1 gene promoter in Gemcitabine-resistant A549/Gem and NCI-H460/Gem cell lines].
20189873 2010 Association of MDR1 and ERCC1 polymorphisms with response and toxicity to cisplatin-based chemotherapy in non-small-cell lung cancer patients.
20143185 2011 Predictive value of ERCC1 and XPD polymorphism in patients with advanced non-small cell lung cancer receiving platinum-based chemotherapy: a systematic review and meta-analysis.
20104194 2010 ERCC1 and Ki67 in small cell lung carcinoma and other neuroendocrine tumors of the lung: distribution and impact on survival.
20085902 2010 Predictive and prognostic values of tau and ERCC1 in advanced breast cancer patients treated with paclitaxel and cisplatin.
20070981 2011 Excision repair cross complementation group 1 polymorphisms predict overall survival after platinum-based chemotherapy for completely resected non-small-cell lung cancer.
20061190 2010 ERCC1 haplotypes modify bladder cancer risk: a case-control study.
20047592 2010 Epidermal growth factor receptor intron 1 CA dinucleotide repeat polymorphism and survival of advanced gastric cancer patients treated with cetuximab plus modified FOLFOX6.
20021611 2009 Expression of ERCC1 and class IIIbeta tubulin for predicting effect of carboplatin/paclitaxel in patients with advanced inoperable non-small cell lung cancer.
20009541 2009 The overexpression of ERCC-1 is involved in the resistance of lung cancer cells to cetuximab combined with DDP.
20003463 2009 Association between polymorphisms in DNA repair genes and survival of non-smoking female patients with lung adenocarcinoma.
20003391 2009 ERCC2, ERCC1 polymorphisms and haplotypes, cooking oil fume and lung adenocarcinoma risk in Chinese non-smoking females.
19960344 2010 The combination of ERCC1 and XRCC1 gene polymorphisms better predicts clinical outcome to oxaliplatin-based chemotherapy in metastatic colorectal cancer.
19956886 2010 ERCC1 and XPF expression in human testicular germ cell tumors.
19940136 2010 The XPA-binding domain of ERCC1 is required for nucleotide excision repair but not other DNA repair pathways.
19922504 2010 Influence of GSTP1 I105V polymorphism on cumulative neuropathy and outcome of FOLFOX-4 treatment in Asian patients with colorectal carcinoma.
19878615 2010 Modulation of nucleotide excision repair in human lymphocytes by genetic and dietary factors.
19875192 2010 Association of expression of MRP1, BCRP, LRP and ERCC1 with outcome of patients with locally advanced non-small cell lung cancer who received neoadjuvant chemotherapy.
19850635 2010 EGF61A>G polymorphism as predictive marker of clinical outcome to first-line capecitabine and oxaliplatin in metastatic colorectal cancer.
19832035 2009 The impacts of ERCC1 gene exon VIII alternative splicing on cisplatin-resistance in ovarian cancer cells.
19822419 2009 CyclinD1 and interleukin-1 receptor antagonist polymorphisms are associated with prognosis in neoadjuvant-treated gastric carcinoma.
19805513 2009 XPF-ERCC1 participates in the Fanconi anemia pathway of cross-link repair.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786980 2010 Genetic polymorphisms and the efficacy and toxicity of cisplatin-based chemotherapy in ovarian cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19687761 2009 Differential expression of biomarkers in primary non-small cell lung cancer and metastatic sites.
19672255 2009 Molecular markers of response and toxicity to FOLFOX chemotherapy in metastatic colorectal cancer.
19667277 2009 Different impact of excision repair cross-complementation group 1 on survival in male and female patients with inoperable non-small-cell lung cancer treated with carboplatin and gemcitabine.
19664717 2009 Relationship between methylation status of ERCC1 promoter and radiosensitivity in glioma cell lines.
19661343 2009 Elevated ERCC1 gene expression in blood cells associated with exposure to arsenic from drinking water in Inner Mongolia.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19636001 2009 Racial differences in advanced colorectal cancer outcomes and pharmacogenetics: a subgroup analysis of a large randomized clinical trial.
19626585 2010 Role of ERCC1 promoter hypermethylation in drug resistance to cisplatin in human gliomas.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19620936 2009 Cisplatin pharmacogenetics, DNA repair polymorphisms, and esophageal cancer outcomes.
19596236 2009 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19580345 2009 Acute lymphoblastic leukemia-derived dendritic cells express tumor associated antigens: PNPT1, PMPCB, RHAMM, BSG and ERCC1.
19574766 2009 The relationship of platinum resistance and ERCC1 protein expression in epithelial ovarian cancer.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19552012 [ERCC1 and RRM1 genes in lung cancer].
19549713 2009 Multicenter phase II study of gemcitabine and oxaliplatin in advanced nasopharyngeal carcinoma--correlation with excision repair cross-complementing-1 polymorphisms.
19543324 2009 Significance of RRM1 and ERCC1 expression in resectable pancreatic adenocarcinoma.
19538866 2009 [Prognostic significance of ERCC1 mRNA expression in patients with non-small cell lung cancer receiving platinum-based chemotherapy].
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19513514 2009 Comprehensive analysis of excision repair complementation group 1, glutathione S-transferase, thymidylate synthase and uridine diphosphate glucuronosyl transferase 1A1 polymorphisms predictive for treatment outcome in patients with advanced gastric cancer treated with FOLFOX or FOLFIRI.
19488864 2010 Positive expression of ERCC1 predicts a poorer platinum-based treatment outcome in Chinese patients with advanced non-small-cell lung cancer.
19470925 2009 Japanese-US common-arm analysis of paclitaxel plus carboplatin in advanced non-small-cell lung cancer: a model for assessing population-related pharmacogenomics.
19434073 2009 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19421825 2009 ERCC1 and XRCC1 gene polymorphisms predict response to neoadjuvant radiochemotherapy in esophageal cancer.
19362955 2009 DNA repair gene polymorphisms predict favorable clinical outcome in advanced non-small-cell lung cancer.
19361884 2010 Effects of excision repair cross-complementation group 1 (ERCC1) single nucleotide polymorphisms on the prognosis of non-small cell lung cancer patients.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19332728 2009 Pharmacogenetic analyses of a phase III trial in metastatic gastroesophageal adenocarcinoma with fluorouracil and leucovorin plus either oxaliplatin or cisplatin: a study of the arbeitsgemeinschaft internistische onkologie.
19318434 2009 Associations between polymorphisms in DNA repair genes and glioblastoma.
19297315 2009 The NER proteins are differentially expressed in ever smokers and in never smokers with lung adenocarcinoma.
19289372 2009 XPG mRNA expression levels modulate prognosis in resected non-small-cell lung cancer in conjunction with BRCA1 and ERCC1 expression.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19258314 2009 The human oxidative DNA glycosylase NEIL1 excises psoralen-induced interstrand DNA cross-links in a three-stranded DNA structure.
19257887 2009 Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups.
19253035 2009 Platinum-based chemotherapy in lung cancer affects the expression of certain biomarkers including ERCC1.
19247656 2009 Polymorphisms in p53, GSTP1 and XRCC1 predict relapse and survival of gastric cancer patients treated with oxaliplatin-based adjuvant chemotherapy.
19240185 2009 Expression of excision repair cross complementing group 1 and prognosis in adrenocortical carcinoma patients treated with platinum-based chemotherapy.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19235214 2010 ERCC1 expression in aseptic loosening after total hip replacement.
19203783 2009 Genetic polymorphisms affecting clinical outcomes in epithelial ovarian cancer patients treated with taxanes and platinum compounds: a Korean population-based study.
19194123 2009 Prognostic value of ERCC1, thymidylate synthase, and glutathione S-transferase pi for 5-FU/oxaliplatin chemotherapy in advanced colorectal cancer.
19173905 2008 [Changes of expression and sequence of ERCC1 in cadmium chloride-induced transformed 16HBE cells at different stages].
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19150580 2009 Expression of excision repair cross-complementation group 1 protein predicts poor outcome in advanced non-small cell lung cancer patients treated with platinum-based doublet chemotherapy.
19124499 2009 Association and interactions between DNA repair gene polymorphisms and adult glioma.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074750 2009 Pharmacogenetic analyses of hematotoxicity in advanced gastric cancer patients receiving biweekly fluorouracil, leucovorin, oxaliplatin and docetaxel (FLOT): a translational study of the Arbeitsgemeinschaft Internistische Onkologie (AIO).
19068092 2009 ERCC1 codon 118 C?T polymorphism associated with ERCC1 expression and outcome of FOLFOX-4 treatment in Asian patients with metastatic colorectal carcinoma.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19035454 2009 The DNA repair proteins BRCA1 and ERCC1 as predictive markers in sporadic ovarian cancer.
19029193 2009 Red meat and poultry intake, polymorphisms in the nucleotide excision repair and mismatch repair pathways and colorectal cancer risk.
19020759 2008 Messenger RNA expression of TS and ERCC1 in colorectal cancer and matched liver metastasis.
19009659 2008 ERCC1 polymorphism, expression and clinical outcome of oxaliplatin-based adjuvant chemotherapy in gastric cancer.
18990748 2008 International Lung Cancer Consortium: pooled analysis of sequence variants in DNA repair and cell cycle pathways.
18990028 Genotype-phenotype relationship between DNA repair gene genetic polymorphisms and DNA repair capacity.
18977553 2009 Expression of ERCC1 and class III beta-tubulin in non-small cell lung cancer patients treated with carboplatin and paclitaxel.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18823676 2009 Immunohistochemical expression of BCRP and ERCC1 in biopsy specimen predicts survival in advanced non-small-cell lung cancer treated with cisplatin-based chemotherapy.
18797464 2008 Pharmacogenetic prediction of clinical outcome in advanced colorectal cancer patients receiving oxaliplatin/5-fluorouracil as first-line chemotherapy.
18756932 2008 [Relationship between nucleotide excision repair gene ERCC1 and resistance to cisplatin in ovarian cancer].
18683754 2008 [Influence of mifepristone on DNA repair genes and cisplatin sensitivity in human ovarian cancer drug-resistance cells].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18672388 ERCC1 is required for FANCD2 focus formation.
18640939 2008 Relationship between ERCC1 polymorphisms, disease progression, and survival in the Gynecologic Oncology Group Phase III Trial of intraperitoneal versus intravenous cisplatin and paclitaxel for stage III epithelial ovarian cancer.
18635523 2008 Genotypes and haplotypes of ERCC1 and ERCC2/XPD genes predict levels of benzo[a]pyrene diol epoxide-induced DNA adducts in cultured primary lymphocytes from healthy individuals: a genotype-phenotype correlation analysis.
18623378 2008 ERCC1 expression as a prognostic marker in N2(+) nonsmall-cell lung cancer patients treated with platinum-based neoadjuvant concurrent chemoradiotherapy.
18616887 2008 ERCC1 and ERCC2 polymorphisms and risk of idiopathic azoospermia in a Chinese population.
18615480 2009 Association of ERCC1 polymorphisms and susceptibility to nasopharyngeal carcinoma.
18604718 2008 High expression of ERCC1, FLT1, NME4 and PCNA associated with poor prognosis and advanced stages in myelodysplastic syndrome.
18594541 2008 ERCC1 expression as a predictive marker of squamous cell carcinoma of the head and neck treated with cisplatin-based concurrent chemoradiation.
18564169 2008 ZNRD1 might mediate UV irradiation related DNA damage and repair in human esophageal cancer cells by regulation of ERCC1.
18520795 2008 Excision repair cross complementing-1 and topoisomerase IIalpha gene expression in small-cell lung cancer patients treated with platinum and etoposide: a retrospective study.
18509181 2008 Predictive biomarkers of chemotherapy efficacy in colorectal cancer: results from the UK MRC FOCUS trial.
18505590 2008 Modified FOLFOX-6 chemotherapy in advanced gastric cancer: Results of phase II study and comprehensive analysis of polymorphisms as a predictive and prognostic marker.
18494946 2008 mRNA expression of RRM1, ERCC1 and ERCC2 is not associated with chemosensitivity to cisplatin, carboplatin and gemcitabine in human lung cancer cell lines.
18483312 2008 Ethnic disparities in Americans of European descent versus Americans of African descent related to polymorphic ERCC1, ERCC2, XRCC1, and PARP1.
18478337 2008 Polymorphisms of the NER pathway genes, ERCC1 and XPD are associated with esophageal adenocarcinoma risk.
18451256 2008 Characterization of functional excision repair cross-complementation group 1 variants and their association with lung cancer risk and prognosis.
18430179 2008 Predictors of response and survival for neoadjuvant treated patients with esophageal adenocarcinoma.
18425336 2008 ERCC1 codon 118 polymorphism is a useful prognostic marker in patients with pancreatic cancer treated with platinum-based chemotherapy.
18396111 2008 ERCC1/XPF limits L1 retrotransposition.
18395930 2008 Expression of excision repair cross-complementation group 1 and class III beta-tubulin predict survival after chemotherapy for completely resected non-small cell lung cancer.
18386788 2008 Polymorphisms in MGMT and DNA repair genes and the risk of esophageal adenocarcinoma.
18358500 2008 Haplotypes of nine single nucleotide polymorphisms on chromosome 19q13.2-3 associated with susceptibility of lung cancer in a Chinese population.
18347182 2008 Correlation of CDA, ERCC1, and XPD polymorphisms with response and survival in gemcitabine/cisplatin-treated advanced non-small cell lung cancer patients.
18332046 2008 A distinct ERCC1 haplotype is associated with mRNA expression levels in prostate cancer patients.
18289367 2008 A haplotype of polymorphisms in ASE-1, RAI and ERCC1 and the effects of tobacco smoking and alcohol consumption on risk of colorectal cancer: a Danish prospective case-cohort study.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18204222 2007 Single nucleotide polymorphisms in nucleotide excision repair genes XPA, XPD, XPG and ERCC1 in advanced colorectal cancer patients treated with first-line oxaliplatin/fluoropyrimidine.
18081788 Protein expression levels of excision repair cross-complementation group 1 and xeroderma pigmentosum D correlate with response to platinum-based chemotherapy in the patients with advanced epithelial ovarian cancer.
18036700 2008 ERCC1 expression by immunohistochemistry and EGFR mutations in resected non-small cell lung cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18026184 2008 NAT2 and NER genetic variants and sporadic prostate cancer susceptibility in African Americans.
18024864 2007 ERCC1 genotype and phenotype in epithelial ovarian cancer identify patients likely to benefit from paclitaxel treatment in addition to platinum-based therapy.
18006494 2008 Processing of a psoralen DNA interstrand cross-link by XPF-ERCC1 complex in vitro.
17987380 2008 ERCC1 expression in triple negative breast carcinoma: the paradox revisited.
17961161 Prediction of response to chemotherapy by ERCC1 immunohistochemistry and ERCC1 polymorphism in ovarian cancer.
17932351 2007 Polymorphisms in nucleotide excision repair genes, polycyclic aromatic hydrocarbon-DNA adducts, and breast cancer risk.
17925548 2007 Pharmacogenetic assessment of toxicity and outcome after platinum plus taxane chemotherapy in ovarian cancer: the Scottish Randomised Trial in Ovarian Cancer.
17912758 2008 The HhH domain of the human DNA repair protein XPF forms stable homodimers.
17720715 2007 Analysis of the XPA and ssDNA-binding surfaces on the central domain of human ERCC1 reveals evidence for subfunctionalization.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17617021 2007 Polymorphisms in genes involved in DNA repair and metabolism of xenobiotics in individual susceptibility to sporadic diffuse gastric cancer.
17614221 2007 Genetic susceptibility of newborn daughters to oxidative stress.
17606717 2007 Excision repair cross complementation group 1 immunohistochemical expression predicts objective response and cancer-specific survival in patients treated by Cisplatin-based induction chemotherapy for locally advanced head and neck squamous cell carcinoma.
17549067 2008 Pharmacogenetic profiling in patients with advanced colorectal cancer treated with first-line FOLFIRI chemotherapy.
17534174 2007 ERCC1 as a risk stratifier in platinum-based chemotherapy for nonsmall-cell lung cancer.
17522621 2007 No association of ERCC1 C8092A and T19007C polymorphisms to cancer risk: a meta-analysis.
17502833 2007 Tagging single nucleotide polymorphisms in excision repair cross-complementing group 1 (ERCC1) and risk of primary lung cancer in a Chinese population.
17438655 Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers.
17401013 2007 Pharmacogenetic profiling in patients with advanced colorectal cancer treated with first-line FOLFOX-4 chemotherapy.
17314486 2007 The C19007T polymorphism of ERCC1 and its correlation with the risk of epithelial ovarian and endometrial cancer in Korean women. A case control study.
17313739 2006 [Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers].
17303907 2006 Effect of ERCC1 polymorphisms and the modification by smoking on the survival of non-small cell lung cancer patients.
17299578 2007 Genetic polymorphisms in the nucleotide excision repair pathway and lung cancer risk: a meta-analysis.
17273966 2007 First reported patient with human ERCC1 deficiency has cerebro-oculo-facio-skeletal syndrome with a mild defect in nucleotide excision repair and severe developmental failure.
17229776 2007 Gene expression of ERCC1 as a novel prognostic marker in advanced bladder cancer patients receiving cisplatin-based chemotherapy.
17222938 2007 Genetic polymorphisms and treatment response in advanced non-small cell lung cancer.
17210993 2007 DNA repair gene polymorphisms and genetic predisposition to cutaneous melanoma.
17197435 2007 Polymorphisms in DNA repair genes and therapeutic outcomes of AML patients from SWOG clinical trials.
17151930 2007 Single nucleotide polymorphisms and expression of ERCC1 and ERCC2 vis-à-vis chemotherapy drug cytotoxicity in human glioma.
17131345 2007 Polymorphisms in the genes ERCC2, XRCC3 and CD3EAP influence treatment outcome in multiple myeloma patients undergoing autologous bone marrow transplantation.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17064812 2006 Pharmacogenomics: a reality or still a promise?
17055345 2007 XPF with mutations in its conserved nuclease domain is defective in DNA repair but functions in TRF2-mediated telomere shortening.
16985021 2006 Polymorphisms in nucleotide excision repair genes and DNA repair capacity phenotype in sisters discordant for breast cancer.
16979838 2006 Single-nucleotide polymorphisms in base excision repair, nucleotide excision repair, and double strand break genes as markers for response to radiotherapy in patients with Stage I to II head-and-neck cancer.
16899630 2006 Genetic effect of ERCC1 codon 118 polymorphism and confounding factors.
16896002 2006 DNA-repair gene polymorphisms predict favorable clinical outcome among patients with advanced squamous cell carcinoma of the head and neck treated with cisplatin-based induction chemotherapy.
16875718 2006 XRCC1 R399Q polymorphism is associated with response to platinum-based neoadjuvant chemotherapy in bulky cervical cancer.
16819291 2006 Association between excision repair cross-complementation group 1 polymorphism and clinical outcome of platinum-based chemotherapy in patients with epithelial ovarian cancer.
16817948 2006 Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.
16756962 2006 XPA versus ERCC1 as chemosensitising agents to cisplatin and mitomycin C in prostate cancer cells: role of ERCC1 in homologous recombination repair.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16723154 2006 Polymorphisms in ERCC1 and susceptibility to childhood acute lymphoblastic leukemia in a Chinese population.
16690207 2007 Gene-environment interactions between smoking and a haplotype of RAI, ASE-1 and ERCC1 polymorphisms among women in relation to risk of lung cancer in a population-based study.
16622263 2006 Pharmacogenetic profiling and clinical outcome of patients with advanced gastric cancer treated with palliative chemotherapy.
16609022 2006 Polymorphisms in genes of nucleotide and base excision repair: risk and prognosis of colorectal cancer.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16510122 2006 Polymorphisms of DNA repair genes are associated with renal cell carcinoma.
16507781 2006 Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
16407418 2006 Polymorphisms in DNA repair genes modulate survival in cisplatin/gemcitabine-treated non-small-cell lung cancer patients.
16393248 2006 Gene-environment interaction involved in oral carcinogenesis: molecular epidemiological study for metabolic and DNA repair gene polymorphisms.
16364765 2006 Lack of association between DNA repair gene ERCC1 polymorphism and risk of lung cancer in a Chinese population.
16351803 2005 [Correlation of genetic polymorphisms in nucleotide excision repair system to sensitivity of advanced non-small cell lung cancer patients to platinum-based chemotherapy].
16341770 2005 Polymorphisms of DNA repair genes: ERCC1 G19007A and ERCC2/XPD C22541A in a northeastern Chinese population.
16341674 2005 Transcriptome analysis of human gastric cancer.
16338413 2005 The structure of the human ERCC1/XPF interaction domains reveals a complementary role for the two proteins in nucleotide excision repair.
16315315 2006 Regulation of DNA repair gene expression in human cancer cell lines.
16308313 2006 DNA repair polymorphisms and cancer risk in non-smokers in a cohort study.
16284380 2005 Polymorphisms/haplotypes in DNA repair genes and smoking: a bladder cancer case-control study.
16284373 2005 Interindividual variation in nucleotide excision repair genes and risk of endometrial cancer.
16224397 2003 ERCC1 gene polymorphism as a predictor for clinical outcome in advanced colorectal cancer patients treated with platinum-based chemotherapy.
16212814 2005 ERCC1 and ERCC2 polymorphisms and adult glioma.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16144923 2005 ERCC1 codon 118 polymorphism is a predictive factor for the tumor response to oxaliplatin/5-fluorouracil combination chemotherapy in patients with advanced colorectal cancer.
16076955 2005 Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
16034668 2005 Resonance assignments for the DNA binding domain of ERCC-1/XPF heterodimer.
15958648 2005 Genetic polymorphisms of selected DNA repair genes, estrogen and progesterone receptor status, and breast cancer risk.
15936590 2005 Effect of polymorphisms in XPD, RAI, ASE-1 and ERCC1 on the risk of basal cell carcinoma among Caucasians after age 50.
15932882 2005 Biophysical characterization of the interaction domains and mapping of the contact residues in the XPF-ERCC1 complex.
15922480 2005 Overexpression of the two nucleotide excision repair genes ERCC1 and XPC in human hepatocellular carcinoma.
15885892 2005 Polymorphisms in RAI and in genes of nucleotide and base excision repair are not associated with risk of testicular cancer.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15788669 2005 High gene expression of TS1, GSTP1, and ERCC1 are risk factors for survival in patients treated with trimodality therapy for esophageal cancer.
15746057 2005 Polymorphisms in ERCC1 and grade 3 or 4 toxicity in non-small cell lung cancer patients.
15746040 2005 Nucleotide excision repair gene polymorphisms and recurrence after treatment for superficial bladder cancer.
15734977 2005 Gene-smoking interaction associations for the ERCC1 polymorphisms in the risk of lung cancer.
15709194 2005 Impact of gene polymorphisms on clinical outcome for stage IV melanoma patients treated with biochemotherapy: an exploratory study.
15688021 2005 Expression of a splicing variant in the 5'-UTR of the human ERCC1 gene is not cancer related.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297394 2004 Excision repair cross-complementation group 1 polymorphism predicts overall survival in advanced non-small cell lung cancer patients treated with platinum-based chemotherapy.
15277258 2004 Single nucleotide polymorphisms and outcome in docetaxel-cisplatin-treated advanced non-small-cell lung cancer.
15213713 2004 A multivariate analysis of genomic polymorphisms: prediction of clinical outcome to 5-FU/oxaliplatin combination chemotherapy in refractory colorectal cancer.
15173087 2004 High specificity of quantitative excision repair cross-complementing 1 messenger RNA expression for prediction of minor histopathological response to neoadjuvant radiochemotherapy in esophageal cancer.
15140544 2004 Association between polymorphisms of ERCC1 and XPD and survival in non-small-cell lung cancer patients treated with cisplatin combination chemotherapy.
15095299 2004 Reduced levels of XPA, ERCC1 and XPF DNA repair proteins in testis tumor cell lines.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14734547 2004 Physical and functional interaction between the XPF/ERCC1 endonuclease and hRad52.
14706347 2004 Functional and physical interactions between ERCC1 and MSH2 complexes for resistance to cis-diamminedichloroplatinum(II) in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690602 2003 ERCC1/XPF removes the 3' overhang from uncapped telomeres and represses formation of telomeric DNA-containing double minute chromosomes.
12869411 2003 Combination of DNA repair gene single nucleotide polymorphisms and increased levels of DNA adducts in a population-based study.
12865926 2003 Lack of involvement of nucleotide excision repair gene polymorphisms in colorectal cancer.
12800797 2003 First clinically useful marker for lung cancer identified.
12645871 2003 Twelve single nucleotide polymorphisms on chromosome 19q13.2-13.3: linkage disequilibria and associations with basal cell carcinoma in Danish psoriatic patients.
12643788 2003 Epidermal growth factor and ionizing radiation up-regulate the DNA repair genes XRCC1 and ERCC1 in DU145 and LNCaP prostate carcinoma through MAPK signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220217 2002 DNA repair gene ERCC1 and ERCC2/XPD polymorphisms and risk of squamous cell carcinoma of the head and neck.
12189194 2002 Inter-individual variation, seasonal variation and close correlation of OGG1 and ERCC1 mRNA levels in full blood from healthy volunteers.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
11936875 2001 Lactacystin enhances cisplatin sensitivity in resistant human ovarian cancer cell lines via inhibition of DNA repair and ERCC-1 expression.
11753647 2001 An ERCC1 splicing variant involving the 5'-UTR of the mRNA may have a transcriptional modulatory function.
11707424 2001 The structure-specific endonuclease Ercc1-Xpf is required for targeted gene replacement in embryonic stem cells.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11062157 2000 Identification of single nucleotide polymorphisms in human DNA repair genes.
11058119 2000 A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA.
10675489 2000 Comparison of two human ovarian carcinoma cell lines (A2780/CP70 and MCAS) that are equally resistant to platinum, but differ at codon 118 of the ERCC1 gene.
10583946 1999 Quality control by DNA repair.
10498399 1999 Expression in normal human tissues of five nucleotide excision repair genes measured simultaneously by multiplex reverse transcription-polymerase chain reaction.
10413517 1999 Domain mapping of the DNA binding, endonuclease, and ERCC1 binding properties of the human DNA repair protein XPF.
10320375 1999 Action of DNA repair endonuclease ERCC1/XPF in living cells.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
9827920 1998 Analysis of mutations at the DNA repair genes in acute childhood leukaemia.
9722633 1998 Mapping of interaction domains between human repair proteins ERCC1 and XPF.
9653453 1998 ERCC1 mutations in UV-sensitive Chinese hamster ovary (CHO) cell lines.
9360634 1997 A nucleotide polymorphism in ERCC1 in human ovarian cancer cell lines and tumor tissues.
9256505 1997 In vitro repair of oxidative DNA damage by human nucleotide excision repair system: possible explanation for neurodegeneration in xeroderma pigmentosum patients.
9013642 1997 Reconstitution of human excision nuclease with recombinant XPF-ERCC1 complex.
8811092 1996 Mutational analysis of the human nucleotide excision repair gene ERCC1.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8275084 1993 Mice with DNA repair gene (ERCC-1) deficiency have elevated levels of p53, liver nuclear abnormalities and die before weaning.
8197175 1994 Formation of a ternary complex by human XPA, ERCC1, and ERCC4(XPF) excision repair proteins.
8197174 1994 Specific association between the human DNA repair proteins XPA and ERCC1.
7657672 1995 Human DNA repair excision nuclease. Analysis of the roles of the subunits involved in dual incisions by using anti-XPG and anti-ERCC1 antibodies.
7598728 1995 Enhancement of damage-specific DNA binding of XPA by interaction with the ERCC1 DNA repair protein.
7559382 1995 Purification and characterization of the XPF-ERCC1 complex of human DNA repair excision nuclease.
6462228 1984 Molecular cloning of a human DNA repair gene.
3290851 1988 Evolution and mutagenesis of the mammalian excision repair gene ERCC-1.
3034490 1986 Identification of DNA repair genes in the human genome.
2821019 1987 Characterization of genes and proteins involved in excision repair of human cells.
2471070 1989 Conserved pattern of antisense overlapping transcription in the homologous human ERCC-1 and yeast RAD10 DNA repair gene regions.
2420469 1986 Molecular characterization of the human excision repair gene ERCC-1: cDNA cloning and amino acid homology with the yeast DNA repair gene RAD10.
1372133 1992 Efficiency and limitations of the hn-cDNA library approach for the isolation of human transcribed genes from hybrid cells.