Property Summary

NCBI Gene PubMed Count 50
PubMed Score 53.54
PubTator Score 70.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (25)

PMID Text
26025650 Erbin loss accelerates cell cycle though down-regulating p21 and p27 expression. Erbin is a novel negative modulator of Akt1-Skp2-p27 signaling pathway.
25521828 Erbin promotes tumourigenesis and tumour growth in colorectal cancer by stabilizing epidermal growth factor receptor
25288731 Erbin is an ErbB2 regulator for breast tumor formation and progression
24813123 analysis of the C-terminal ligand specificity of the erbin PDZ domain
24142719 Data suggest that Erbin can interact with Sema4C, and co-expression of Erbin blocks the process of Sema4C-induced epithelial-mesenchymal transition.
23711387 Data reveal that Erbin is a negative regulator of AKT activation and suggest that Erbin may play a role in breast cancer progression.
23524970 DSG1 and Erbin cooperate to repress MAPK signaling and promote keratinocyte differentiation.
22880131 These results unravel a critical role of c-Myb in promoting Erbin transcription in G2/M phase and also predict an unappreciated function of Erbin in cell cycle progression.
22745766 Data conclude that LAP2 is widely overexpressed in diverse digestive tract cancers and LAP2beta regulates motility of cancer cells and suggest that LAP2beta may have utility for diagnostics and therapeutics in digestive tract cancers.
21878490 ERBIN binds to SARA using a domain (amino acids 1208-1265) that also interacts with SMAD2 and SMAD3, which we have called the SSID (SARA- and SMAD-interacting domain)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19187442 This review discusses all-intracellular and membrane-associated localization of Densin-180 and its signaling, including a phosphorylation-rich area.
19013433 Arginine 279, glutamic acid 246 in Smad3 and glutamic acid 1321 in Erbin are important for these proteins binding.
18667832 erbin acts as a negative regulator of beta-catenin/T-cell-factor-dependent gene expression. An erbin mutant with a deletion of the N-terminal leucine-rich repeat allows the PDZ domain of erbin to increase beta-catenin/T-cell-factor-dependent transcription
18498353 Both palmitoylation and leucine-rich repeats are required for the plasma membrane localization of ERBIN.
17591701 Results define Erbin as a novel negative modulator of Smad2/Smad3 functions and expand the physiological role of Erbin to the regulation of TGFbeta signaling.
17100642 ErbB2, APC, beta-catenin, c-Rel and HTLV-1 Tax were identified as ligands of the PDZ domain of Erbin.
16737969 Structural analyses reveal that the differences between Erbin PDZ domain and the first PDZ domain of ZO-1 in specificity can be accounted for by two key differences in primary sequence.
16301319 Erbin has a regulatory role in the Ras-Raf-MEK pathway and may inhibit ERK activation by disrupting the Sur-8-Ras/Raf interaction
16203728 Erbin is a regulator of Nod2-dependent NF-kappaB signaling with a role in inflammatory responses
12966186 In this review, erbin is shown to inhibit epidermal growth factor signaling by preventing the activation of the Raf-1 kinase by Ras.
12444095 selective binding and sequestration of this residue in its unphosphorylated state by the Erbin PDZ provides a novel mechanism for regulation of the ErbB2-mediated signaling and oncogenicity
12379659 Erbin is a novel suppressor of Ras signaling by disrupting the Ras-Raf interaction; a negative regulator of the Ras-Raf-Erk signaling pathway
12047349 interacts in vivo with p0071 and may be involved in the organization of adherens junctions and the desmosomes of epithelia
11821434 PDZ domain binds with high affinity and specificity to the carboxyl termini of delta-catenin and ARVCF

AA Sequence

MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQS      1 - 70
LHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNL     71 - 140
TQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLK    141 - 210
EFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITT    211 - 280
LKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVL    281 - 350
FLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM    351 - 420
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNLKRYPTPYPDE    421 - 490
LKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQK    491 - 560
ISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALS    561 - 630
NNKKDDTKETDSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDE    631 - 700
NFNSLLQNGDILNSSTEEKFKAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKL    701 - 770
ITNDTFQPEIMERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHD    771 - 840
SDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVKITSAVDGKNI    841 - 910
VRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRGPTSGPQSAPQIYGPPQYNIQ    911 - 980
YSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTAYHLHQRLGP    981 - 1050
ARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMM   1051 - 1120
PGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKS   1121 - 1190
KVPRDWREQVLRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQM   1191 - 1260
GQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDP   1261 - 1330
ELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQN   1331 - 1400
TVELIIVREVSS                                                             1401 - 1412
//

Text Mined References (59)

PMID Year Title
26025650 2015 Erbin loss promotes cancer cell proliferation through feedback activation of Akt-Skp2-p27 signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25521828 2015 Erbin interacts with c-Cbl and promotes tumourigenesis and tumour growth in colorectal cancer by preventing c-Cbl-mediated ubiquitination and down-regulation of EGFR.
25288731 2014 Role of Erbin in ErbB2-dependent breast tumor growth.
24813123 2014 Alteration of the C-terminal ligand specificity of the erbin PDZ domain by allosteric mutational effects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24142719 2013 Erbin interacts with Sema4C and inhibits Sema4C-induced epithelial-mesenchymal transition in HK2 cells.
23711387 2013 Downregulation of Erbin in Her2-overexpressing breast cancer cells promotes cell migration and induces trastuzumab resistance.
23524970 2013 Desmoglein-1/Erbin interaction suppresses ERK activation to support epidermal differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22880131 2012 c-Myb regulates cell cycle-dependent expression of Erbin: an implication for a novel function of Erbin.
22745766 2012 LAP2 is widely overexpressed in diverse digestive tract cancers and regulates motility of cancer cells.
21878490 2011 ERBIN is a new SARA-interacting protein: competition between SARA and SMAD2 and SMAD3 for binding to ERBIN.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19187442 2009 Densin-180: revised membrane topology, domain structure and phosphorylation status.
19013433 2009 Biochemical studies and molecular dynamics simulations of Smad3-Erbin interaction identify a non-classical Erbin PDZ binding.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667832 2008 The PDZ protein erbin modulates beta-catenin-dependent transcription.
18498353 2008 Palmitoylation of ERBIN is required for its plasma membrane localization.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17591701 2007 Erbin inhibits transforming growth factor beta signaling through a novel Smad-interacting domain.
17100642 2006 Interaction partners of the PDZ domain of erbin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16737969 2006 Comparative structural analysis of the Erbin PDZ domain and the first PDZ domain of ZO-1. Insights into determinants of PDZ domain specificity.
16714539 2006 Role for erbin in bacterial activation of Nod2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301319 2006 Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex.
16203728 2005 A role for Erbin in the regulation of Nod2-dependent NF-kappaB signaling.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12966186 2003 Erbin: sorting out ErbB2 receptors or giving Ras a break?
12650946 2003 Identification of three novel Smad binding proteins involved in cell polarity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446668 2003 Origins of PDZ domain ligand specificity. Structure determination and mutagenesis of the Erbin PDZ domain.
12444095 2003 Novel mode of ligand recognition by the Erbin PDZ domain.
12379659 2003 Erbin suppresses the MAP kinase pathway.
12370826 2002 Localization of p0071-interacting proteins, plakophilin-related armadillo-repeat protein-interacting protein (PAPIN) and ERBIN, in epithelial cells.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12047349 2002 ERBIN associates with p0071, an armadillo protein, at cell-cell junctions of epithelial cells.
11821434 2002 The Erbin PDZ domain binds with high affinity and specificity to the carboxyl termini of delta-catenin and ARVCF.
11711544 2002 Interaction between Erbin and a Catenin-related protein in epithelial cells.
11440998 2001 Lano, a novel LAP protein directly connected to MAGUK proteins in epithelial cells.
11375975 2001 The hemidesmosomal protein bullous pemphigoid antigen 1 and the integrin beta 4 subunit bind to ERBIN. Molecular cloning of multiple alternative splice variants of ERBIN and analysis of their tissue expression.
11279080 2001 Erbin is a protein concentrated at postsynaptic membranes that interacts with PSD-95.
11278603 2001 The ERBB2/HER2 receptor differentially interacts with ERBIN and PICK1 PSD-95/DLG/ZO-1 domain proteins.
10878805 2000 ERBIN: a basolateral PDZ protein that interacts with the mammalian ERBB2/HER2 receptor.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.