Property Summary

NCBI Gene PubMed Count 250
PubMed Score 526.08
PubTator Score 488.94

Knowledge Summary

Patent (110,652)

TINX Plot

  Disease (8)

Expression

  Differential Expression (21)

Disease log2 FC p
ependymoma -1.200 3.8e-02
cutaneous lupus erythematosus -1.500 3.5e-03
psoriasis -2.700 1.7e-05
glioblastoma -2.900 3.9e-03
medulloblastoma, large-cell -2.700 4.7e-06
non-small cell lung cancer -1.462 5.8e-20
intraductal papillary-mucinous adenoma (... -1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... -2.300 6.4e-03
lung cancer 2.200 2.1e-05
fibroadenoma 1.500 2.5e-02
diabetes mellitus -1.200 3.5e-02
lung adenocarcinoma -1.500 2.2e-14
pediatric high grade glioma -1.800 3.7e-03
subependymal giant cell astrocytoma -2.968 1.1e-02
Endometriosis -1.223 1.5e-02
inflammatory breast cancer -2.400 1.4e-02
lung carcinoma -1.600 2.7e-16
gastric carcinoma -1.100 1.9e-02
chronic rhinosinusitis -1.595 3.0e-03
cystic fibrosis and chronic rhinosinusit... -1.730 4.4e-03
facioscapulohumeral dystrophy 2.700 1.2e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (201)

PMID Text
27069134 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study
26907936 Results from the expression profile of ERBB4 suggest that it might serve as a prognostic marker in patients with triple negative breast cancer.
26886748 while transcript and protein levels of EGFR and ErbB2 were up-regulated or unaffected, respectively, hepatitis c virus induced a substantial reduction of ErbB3 and ErbB4 expression.
26780728 In this study, we developed an anti-ErbB4 mAb (clone P6-1) that suppresses NRG-dependent activation of ErbB4 and examined its effect on breast cancer cell proliferation in the extracellular matrix.
26701850 Genetic variants in ERBB4 is associated with chronic hepatitis B virus infection.
26648299 NRG1 promotes the proliferation and migration of coronary artery smooth muscle cells by enhancing the phosphorylation of ErbB2, ErbB3 and ErbB4.
26535009 The connections of EGFR and ERBB4 signaling with SREBP-2-regulated cholesterol metabolism are likely to be important in ERBB-regulated developmental processes and may contribute to metabolic remodeling in ERBB-driven cancers.
26463425 Identification of a new subclass of ALK-negative Anaplastic large-cell lymphoma characterized by aberrant expression of ERBB4-truncated transcripts carrying intronic 5' untranslated regions.
26418945 This study reveals a novel pathway that directly links ErbB4 and p38gamma to the transcriptional machinery of NKx2.5-GATA4 complex which is critical for cardiomyocyte formation during mammalian heart development.
26365191 A combination of miRNAs induced via endothelial coculture improved embryonic-stem-cell-derived cardiomyocytes maturity, in part through suppression of ErbB4 signaling.
26337038 Dysregulated ErbB4splicing in schizophreniamay contribute to lower activity of parvalbumin interneurons and an activity-dependent down-regulation of parvalbumin expression.
26238412 nuclear HER4 seem to be co-located with estrogen receptors, however, we did not find support for overall HER4 expression in independently predicting response of tamoxifen treatment in breast cancer
26050618 the presence of activating driver mutations of ERBB4 in non-small cell lung cancer
26021752 The aim of the study was to evaluate the prognostic ability of the transcriptional profiling of the HER family genes in early breast cancer.
25916654 ERBB4 is over-expressed in human colon cancer and enhances cellular transformation.
25744101 Authors investigated the effects of ERBB4 variants and family history of SCZ and/or BPD (FH) on cortical measures and cognitive performances.
25740878 EGFR/ERBB4 expression in trophoblasts correlates with cell cycle progression and hyperplasia in complete hydatidiform moles
25731189 Report high expression of HER2 in gastric adenocarcinomas.
25516216 There are isoform-specific roles of ERBB4 during puberty and early pregnancy. CYT-1 ERBB4a has oncogenic properties.
25492965 These observations connect the unusual nuclear function of a growth factor receptor with a mechanosensory pathway and suggest that NRG1-ERBB4-YAP signaling contributes to the aggressive behavior of tumor cells.
25492964 identifying neuregulin 1 and its cognate receptor ERBB4 [epidermal growth factor receptor (EGFR) family member v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4] as a major receptor complex that activates YAP activity
25468910 analysis of activator-receiver preferences among ErbB proteins: EGFR/ErbB1 is the strongest receiver, followed by ErbB2 and then ErbB4; that cis-phosphorylation of EGFR and ErbB2 appears to be negligible
25416285 Phosphorylated ErbB1-4 and heregulin contribute to poorer patient prognosis in CRC. This heregulin-ErbB family member autocrine loop may be a candidate for targeted treatment of CRC.
25391651 Taken together, our findings provide the first clues regarding the role of miR-193a-3p as a tumor suppressor in lung cancer through the inhibition of ERBB4 translation.
25335735 Our data suggested that individuals in Chinese population with the ErbB4 12-bp deletion allele may be at higher risk for CRC, rs6147150 would potentially be a promising novel biomarker for Colorectal cancer susceptibility
25216938 NRG4 and its receptor ErbB4 are present in human breast milk and developing human intestine, respectively. Thus, NRG4-ErbB4 signaling may be a novel pathway for therapeutic intervention or prevention in NEC.
25142529 A small cluster located in the 5' end of the ERBB4 gene showed a nominal association mainly with negative, general and total dimensions of the Positive and Negative Syndrome Scale.
25140053 An exon array analysis of 155 breast tumors revealed that the relative mRNA abundance of the ErbB4 CYT2 variant was increased in ER+ HER2- breast cancer patients
25036186 germ-line ERBB4 variant -815A>T as a novel prognostic marker in high-risk early breast cancer
25003574 In 238 primary invasive breast cancer patients, authors analyzed the expression levels of HER4 extracellular (JM-a and JM-b) and intracellular (CYT-1 and CYT-2) domains
24927194 Data shows that HER4 expression status allows stratification of Cholangiocarcinoma patients into different survival categories.
24901400 ErbB3, ErbB4, and MET showed marked expression in 76%, 98%, and 96% of ovarian carcinoma cases.
24893630 Elevated ERBB4 expression is associated with drug resistance in colorectal cancer.
24862237 Study addresses whether the ERBB3 mutations altering Val-104 were present in homologous amino acids of ERBB family genes EGFR, ERBB2 and ERBB4 in CRC.
24829397 The diverse biologic activities of ERBB4 isoforms.
24636039 This study provide evidence from this independent Australian postmortem cohort that ErbB4-JMa expression is elevated in schizophrenia.
24469061 discovered that ERBB4 and S6K2 were the direct targets of miR-193a-3p and that PIK3R3 and mTOR were the direct targets of miR-193a-5p in non-small-cell lung cancer
24438167 MiR-302b is a potential molecular marker of esophageal squamous cell carcinoma and functions as a tumor suppressor by post-transcriptionally regulating ErbB4.
24366194 Results further emphasize the role of HER4 as an important oncogene in malignant melanoma.
24338375 these results support a cooperation of ErbB1, ErbB4, and members of the MMP family in predicting OSCC invasion and poor clinical outcomes.
24333426 In summary, we demonstrate for the first time that a cell surface receptor functions as an obligate ER coactivator with functional specificity associated with breast tumor cell proliferation and cell cycle progression.
24318637 Studied molecular and network models of HER4/ErbB4 activation and signaling in order to elucidate molecular mechanisms of activation and rationalize the effects of the clinically identified HER4 somatic mutants.
24308844 Data suggest that WW2 domain of WWOX (WW domain containing oxidoreductase protein) augments binding of WW1 domain of WWOX to PPXY motifs within intracellular domain of ErbB4, implying that WW2 serves as chaperone within WW1-WW2 tandem module of WWOX.
24119685 reduced autophosphorylation of ErbB4 upon NRG-1 stimulation is involved in the pathogenesis of amyotrophic lateral sclerosis
24063248 our study reveals a positive impact of Her4 (JM-a) expression in triple-negative (OS) and Her2/ER-positive (EFS) breast cancer.
24015958 Expression of HER4 JM-a/CYT2 isoform relate to survival of bladder cancer patients only if the tumors do not express ESR1.
23999525 these data suggest that Nrg3/ErbB4 signaling may be an important factor in nicotine dependence.
23991224 In tumours from postmenopausal women harbouring normal HER2 gene copy numbers, we found HER2 and HER4, but HER3 levels in particular, to be elevated compared to normal tissues
23927961 Data provide evidence for the involvement of intron 1 EGFR variants and intron 24 ERBB4 variants in modulating risk for the development of in situ and invasive cervical cancer.
23723069 Data indicate that Lrig3 opposes Lrig1 negative regulatory action and enhances ErbB receptors ERBB2, ERBB3 and ERBB4 stability.
23681745 ERBB4 expression is elevated in metastatic tumour samples and correlates with disease progression in Ewing sarcoma.
23543049 The association of SNP loci derived from GWAS in European type 1 diabetes with diabetic nephropathy was not replicated in the Japanese patients with type 2 diabetes, although the ERBB4 locus may have some effect also in Japanese type 2 diabetes.
23432624 No cross-reactivity of 4B5 with membrane-bound HER4 was identified in the clinical IHC analysis of formalin-fixed paraffin-embedded breast carcinoma cases as evidenced by the HER4 antibody clone E200.
23395558 Data suggest that ErbB receptors (ERBB2, ERBB3, and ERBB4) are expressed in most endometrial cancers; expression of ErbB receptors appears to be related to poor prognosis; dismal outcomes correlate with cancers positive for all three ErbB receptors.
23340734 There is no enrichment of ERBB4 mutations BRAF/INRAS mutant melanoma cells.
23333248 The present data suggest that ErbB2, ErbB3, and ErbB4 genes may have a role in bladder cancer tumorigenesis.
23313737 total ErbB4 protein expression was not significantly associated with prognostic markers
23301017 identified a novel 6-kb haplotype block in ERBB4 which was significantly associated with risk of developing schizophrenia Caucasians
23237222 The study indicates that hotspot mutations in the ERBB4 gene are rare in Chinese patients with melanomas.
23230144 Thus, our findings reveal c-Src-mediated inhibitory regulation of ErbB4 nuclear signaling upon EGFR activation.
23137868 Results suggest a possible participation of erbB1-4 and claudin-1 in tissue remodelling in chronic hypertrophic rhinitis.
23123776 Rate of ErbB4 expression in remaining nigral dopaminergic neurons increases in Parkinson disease.
23100016 Low ErbB4 expression is associated with metastasis in breast cancer.
22891299 We observed the reaction kinetics between fluorescently labeled single HRG molecules and ErbB3/B4 on the surfaces of MCF-7 human breast cancer cells.
22854050 HER4 expression was not associated with prognostic factors in ER-positive breast cancer.
22761786 ErbB4 processing is enhanced in breast cancer tissue in vivo
22739235 This effect was blocked by the inhibition of ErbB4, a key NRG1 receptor.
22699492 We report cell-based assays that provide evidence for active, singly ligated dimers of human EGFR and its homolog, ErbB4/HER4.
22634065 Although statistically not significant, the tendency towards associations between ERBB4 polymorphisms and the risk of schizophrenia and SPEM abnormality in this study from a Korean population would be helpful for further genetic studies in schizophrenia.
22606006 amplification of ERBB4, C-MET and CD44 was significantly associated with certain clinicopathological characteristics, particularly tumor differentiation and cancer-related death and poor survival.
22584572 PIAS3 is a novel regulator of ErbB4 receptor tyrosine kinase, controlling its nuclear sequestration and function.
22554477 This study revealed that the previously described up-regulation of EGFR and down-regulation of ERBB4 occurred in all analyzed renal cell carcinoma types, whereas down-regulation of ERBB2 and LRIG1 was only present in clear cell renal cell carcinoma.
22549119 The A-allele of rs7598440 in ERBB4 is associated with increased gamma-aminobutyric acid (GABA) concentrations in the central nervous system.
22504067 Transgenic mouse embryos lacking ErbB4 display deficits in early oligodendrocyte precursor cell migration away from different oligodendrogliogenic regions.
22452962 A genome-wide association study identifies a breast cancer risk variant in ERBB4 at 2q34 in Korean women.
22415601 current results indicated that HER4 protects NBL cells from multiple exogenous apoptotic stimuli, including anoikis, nutrient deficiency, and cytotoxic chemotherapy.
22378872 ErbB4 mutant mice exhibit hyperactivity in a novel environment and deficits in prepulse inhibition of the startle response.
22327010 Immunoreactivity for erbB1 was strong and that for erbB2 and 3 was moderate, while that for erbB4 was faint in nasal mucosa chronic rhinitis.
22308027 soluble ErbB4 intracellular domain promotes HIF-1alpha stability and signaling via a novel mechanism.
22294845 Data suggest that the rs6147150 polymorphism of ErbB4 may be associated with hepatocellular carcinoma (HCC) risk, in part through let-7c-mediated regulation, and may be involved in the pathogenesis of HCC in Chinese populations.
22115776 Verbal working memory performance was associated with 2 variants of ERBB4. No associations were detected between ERBB4 variants and trait schizotypy. rs7598440 was associated with psychotic experiences expressed under stressful environmental conditions.
22012915 Report here the 2.5 A crystal structure of the N-terminal three extracellular domains of ErbB4, which bind ligand but lack domain IV and thus the tether contact.
21993442 No significant association between ErbB4 and bipolar affective disorder, major depressive disorder and schizophrenia is found in the Han Chinese population.
21832192 ErbB4 rs7598440 genotype significantly predicts cortical GABA concentration, with (A) adenosine allele carriers having higher GABA as predicted by allelic impact on ErbB4 expression.
21805036 The HER4 is expressed in lymphoma cells, especially in MALT and FL cells of the gastrointestinal tract.
21664604 data provide evidence for conserved expression patterns of ErbB4 across different rodent and primate species, both at the cellular and subcellular level.
21637803 A modestly associated novel variant that could affect alternative splicing of ERBB4, was found..
21547347 Letter: ErbB4 gene amplification does not play a major role in malignant melanoma.
21422241 the kinase-domain makes a significant contribution to the overall dimerization affinity of the full-length Her4 protein
21407808 148 Penile squamous cell carcinoma were microarrayed and immunostained for phosphorylated EGFR (pEGFR), HER2, HER3, HER4, phosphorylated Akt (pAkt), Akt1 and PTEN proteins.
21290564 Association of common variants in ERBB4 with congenital left ventricular outflow tract obstruction defects.
21233683 data indicate that somatic point mutation of ERBB4 gene is rare in common solid cancers except malignant melanoma; also, they suggest that ERBB4 mutation may play roles in limited types of human cancers
21232925 this study found that genetic variation at the rs4673628 locus in the ErbB4 gene was significantly associated with anterior limb of the internal capsule white matter. integrity which was also significantly and positively associated with mnemonic function
21217148 Data show that interactions between beta1 integrin and ErbB4 occur in a spatiotemporally-regulated manner, and such interaction contributes to the integrin-dependent cell migration.
21203803 HER receptor family plays an important role in embryonic development and in pathogenesis and progression of neuroblastic tumors.
20975381 ERBB4 mutations and expression was not associated with lung cancer.
20975381 Observational study of gene-disease association. (HuGE Navigator)
20921115 We observed epistasis between NRG1 (rs10503929; Thr286/289/294Met) and its receptor ERBB4 (rs1026882; likelihood ratio test P = .035); a 3-way interaction with these 2 SNPs and AKT1 (rs2494734) was also observed.
20921115 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20886074 Novel splice variants of ErbB4 exist in the developing and adult human brain.
20881644 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603612 verified HER4 promoter methylation in primary breast carcinomas and detected a significant increase in HER4 promoter methylation in HER4-negative breast tumors
20600594 The result of this study supported the involvement of the ERBB4 gene in schizophrenia in Han Chinese in Taiwan..
20600594 Observational study of gene-disease association. (HuGE Navigator)
20585313 chronic overexpression of ErbB4 in the context of inflammation could contribute to colitis-associated tumorigenesis by inhibiting colonocyte apoptosis
20550710 The HER4 intracellular domain is a physiologically important ERalpha coactivator and cooperates with ERalpha to potentiate PgR expression in the normal and malignant breast.
20446891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20303366 Data suggest that pulmonary ErbB4 deletion results in a structural and functional delay in fetal lung development, indicating a crucial regulatory role of ErbB4 in the timely progression of fetal lung development.
20204273 EGFR, HER-2 and HER-4 expression is not associated with poorer survival in neuroendocrine cancer
20022944 Data demonstrate that sequence differences on the C-lobe surface influence the heterodimerization and activation of ErbB2/4 kinase domains.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19808643 Results suggest that the HER4 intracellular cytosolic domain 4ICD has important pathological functions and may be used to identify node-negative breast cancer patients at low risk of relapse and an improved survival.
19736351 Observational study of gene-disease association. (HuGE Navigator)
19718025 Melanoma cells expressing mutant ERBB4 had reduced cell growth after shRNA-mediated knockdown of ERBB4
19718025 Observational study of gene-disease association. (HuGE Navigator)
19624808 Both HER4 expression and HER4 gene amplification emerged as independent prognostic markers in Herceptin-treated breast cancer patients and responsiveness to Herceptin turned out to be more efficient if tumour cells show HER4 expression.
19609946 Data show that aberrant expression of ErbB2, ErbB3 and ErbB4 in the two resistant cell lines, suggesting the existence of an autocrine loop leading to constitutive activation of MAPK and PI3K/Akt survival pathways.
19596786 The Cyt1 and Cyt2 ErbB4 isoforms, differing by only 16 amino acids, exhibit markedly opposing effects on mammary epithelium growth and differentiation.
19561640 WWP1 and its family members suppress the ErbB4 expression and function in breast cancer
19481955 Current data relating to the prognostic significance of HER3 and 4 receptors, as well as their impact on the activity of HER-targeting therapies in patients with breast cancer.
19447869 Results showed that 45.8% of typical carcinoid and 28.6% of atypical carcinoid tumors express EGFR, 100% of the tumors lack expression of ErbB2, and 100% have moderate to intense staining for ErbB3 and ErbB4.
19439407 estrogen receptor splice variant and ErbB4 may have roles in gene susceptibility pathways in schizophrenia
19390858 expression of ErbB3 and ErbB4 may identify a colorectal cancer subgroup with stage II and III colorectal cancer at higher risk of recurrence
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19263517 Poor downregulation of ErbB4 receptors is not due to sequence variations in the Proto-Oncogene Proteins Cbl binding site of these receptors.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19171023 Removal of cell surface heparan sulfate increased TACE activity and cleavage of ErbB4 receptor.
19148499 The biological function and clinical implications of HRG, HER-3 and HER-4 in breast cancers negative/low expression of HER-2 remain unclear
19098003 selective loss-of-function mutations of ErbB4 failed to phosphorylate STAT5 and suppressed differentiation of mammary carcinoma.
19017278 results suggest that ErbB4 processing and function may be altered in brain tumours, such as medulloblastoma and pilocytic astrocytoma, via differential expression of juxtamembrane transcript variants.
18985033 HER3 and HER4 gene transcription is associated with better prognosis in high-risk early breast cancer
18973758 ErbB4 expression and signaling are key elements for TNF responses in vivo and in cell culture, protecting intestinal epithelial cells from apoptosis in the inflammatory environment.
18721752 several previously unrecognized interactions led to the finding that ErbB4 can recruit and activate STAT1; at a systems level, ErbB4 is much more selective than the other ErbB receptors
18668031 our results suggest that variations of the ErbB4 genotype may confer risk for schizophrenia illness via its impact on left frontotemporal connectivity in human brain.
18668031 Observational study of gene-disease association. (HuGE Navigator)
18662768 The restriction of robust SVZ ErbB4 expression to neonate and infant age groups may indicate that SVZ-derived ErbB4-dependent postnatal neuronal development is most extensive within a narrow time frame early after birth.
18424286 Her 4 expression showed significantly decreased expression in differentiated throid cancer and correlated with lower T stage
18335053 Ras activation dynamics is dominated by heterodimer-mediated signaling coordination with a large initial speed of dimerization when the concentration of the ErbB4 receptor is considerably high
18334220 All ErbB4 residues contacted by lapatinib are conserved in the EGF receptor and HER2/ErbB2, which lapatinib also targets.
18182100 HER4 amplification showed a positive trend in overall and disease-free survival.
18094435 Observational study of gene-disease association. (HuGE Navigator)
18094435 The ERBB4 -782 G>T polymorphism, by virtue of its in vitro functional implication and incidence, is a risk factor for breast and colorectal cancer.
17969526 ErbB3 and ErbB4 genes play different roles in carcinogenesis and development, and relate to the reccurrence of carcinoma.
17945187 Gln43 of NRG2beta is both necessary and sufficient for NRG2 stimulation of ErbB4 coupling to IL3 independence.
17909041 Expression of Wwox is associated with ErbB4 expression and that their coexpression has prognostic significance in breast cancer.
17903305 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17761534 ErbB4 isoform that is proteinase cleavable but does not contain a PI3K-binding domain in its cytoplasmic tail, mediates important functions in renal epithelial cells in response to HB-EGF
17681096 study concludes that erbB4 mutations are rare in Japanese people with lung cancer
17638867 cycle-dependent degradation of s80(HER4) limits its growth-inhibitory action, and stabilization of s80(HER4) enhances tumor suppression, thus providing a link between HER4-mediated growth inhibition and cell cycle control
17598910 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17505063 Inhibits mammary cell proliferation through the action of its cytoplasmic domain.
17487277 Observational study of gene-disease association. (HuGE Navigator)
17164265 Dysregulation of splice-variant specific expression of ErbB4 in the brain underlies the genetic association of the gene with schizophrenia.
17018285 Data show that upon neuregulin-induced activation and presenilin-dependent cleavage of ErbB4, the receptor's intracellular domain forms a complex with TAB2 and the corepressor N-CoR.
16934755 phosphorylation of ErbB4 tyrosine 1056 is critical for coupling ErbB4 to prostate tumor suppression
16914727 These results suggest that heregulin-mediated growth inhibition in HER4-postive breast cancer cells requires BRCA1.
16912174 Contribution of an autocrine ERBB4/estrogen receptor signaling pathway to tumor growth and therapeutic response should be considered when managing patients with ER-positive breast cancer.
16891421 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16878160 low-level hedgehog signalling in human medulloblastoma is associated with the selective maintenance of high ErbB-4 CYT-1 expression, an alteration that exerts tumor-promoting effects
16842254 Expression of c-erbB-4 in brain medulloblastoma and its correlation with prognosis.
16832345 Down regulation of ERBB4 is associated with brease, prostate and ovarian cancer
16819515 -16 E5 protein can form a complex with ErbB4 via binding to the extracellular and transmembrane domains of ErbB4 (JM-b/CYT-1)
16778220 Cytosolic but not membrane ERBB4/4ICD expression in primary human breast tumors was associated with tumor apoptosis, providing a mechanistic explanation for the loss of ERBB4 expression during tumor progression.
16767099 Neurogulin 1 induced activation of erbB4 in the prefrontal cortex in schizophrenia.
16729043 ErbB4 has 5 docking sites for Grb2. It is a direct binding partner for STAT5. It functions as control center & integration site for signaling processes, involving stimulation with neuregulin.
16685269 HER3 and HER4 has been related to a favourable prognosis in bladder cancer.
16606438 Function of HER4 and its fragments is particularly important, with \the different functions of nuclear and mitochondrial HER4 in breast cancer.
16518842 These experiments demonstrate a novel mechanism controlling ErbB receptor activation. Ras induces ErbB4 receptor phosphorylation in a non-autocrine manner and this activation depends on multiple Ras effector pathways and on ErbB4 kinase activity.
16477370 ErbB4 receptor expression was accompanied with positive regulation of PP2A for phosphorylation of Shc Tyr317 and its downstream ERK phosphorylation in MCF-7 and SK-OV-3 cell lines, but not in LNCaP and PC-3 cells.
16463386 A monoclonal antibody to ErbB-4 showed both an inhibitory effect on growth rate and an increasing apoptotic rate in the cells expressing ErbB-4.
16428439 Activation of Rac by heregulin beta1 is mediated not only by ErbB3 and ErbB2 but also by transactivation of EGFR, and it is independent of ErbB4.
16402353 Observational study of gene-disease association. (HuGE Navigator)
16402353 Results showed a highly significant difference between patient and control groups in three SNPs from one linkage disequilibrium block both in allele and genotype frequencies, as well as a risk haplotype.
16251361 novel transforming mechanism for the ErbB4 receptor in human breast cancer that is 1) specific for a single receptor isoform and 2) depends on proteinase cleavage and kinase activity but not ligand activation of the receptor
16249994 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16249994 Mutation screening of erbB4 in 14 schizophrenics revealed 15 SNPs.
16203964 Results report the 2.4 A crystal structure of the extracellular region of human ErbB4 in the absence of ligand and show that it adopts a tethered conformation similar to inactive forms of ErbB1 and ErbB3.
16187281 Data suggested that alterations of ERBB4-mediated signaling pathway by ERBB4 mutations may contribute to the development of human cancers.
16170367 the s80 domain of ErbB-4 may function to phosphorylate substrates in the cytoplasm or nucleus
16061658 WWOX antagonizes the function of YAP by competing for interaction with ErbB-4 and other targets and thus affect its transcriptional activity.
15985438 Data show that expression of the ErbB-4 ICD fragment leads to its constitutive association with and tyrosine phosphorylation of Mdm2.
15979989 HB-EGF may play a vital role in regulating luteal growth in a juxtacrine manner and through activating HER4 signalling
15788662 Absence of HER4 expression is associated with recurrence of ductal carcinoma in situ of the breast
15746097 proteolytic processing of ERBB4 is a critical event regulating multiple receptor signaling activities
15735025 Association of ErbB4 expression with clinical outcome is dependent on the subcellular localization of ErbB4 and that a proteinase-cleavable ErbB4 isoform promotes growth of ER-positive breast cancer and enhances ER-mediated gene transcription.
15685397 erbB receptor inactivation by unknown mechanisms results in altered splicing of bcl-x towards enhanced formation of proapoptotic Bcl-xS, thereby contributing to enhanced apoptotic susceptibility of failing human myocardium
15562026 ErbB4 is increased by cAMP, a potent inducer of decidualization of the endometrial stroma.
15534001 nuclear localization of STAT5A and stimulation of the beta-casein promoter requires nuclear translocation of the ERBB4 intracellular domain 4ICD; binding of the two proteins at transcription factor target promoters results in activation of gene expression
15248827 betacellulin may play a role as a local growth factor in promoting the differentiated villous trophoblastic function via ErbB-1 in early placentas and in contributing to placental growth through EVT cell function via ErbB-4 in term placentas.
15084248 HER4 is involved in a non-proliferative or even protective role in breast cancer.
15026342 Nuclear localization of the activated p80 fragment of Her-4 is associated with osteosarcoma pathogenesis
12869563 ErbB-4 characterization of the cleavage site and m80 fragment
12807903 YAP is a potential signaling partner of the full-length ErbB4 receptor at the membrane and of the COOH-terminal fragment of ErbB-4 that translocates to the nucleus to regulate transcription
12678544 Expression of HER4 protein correlates with favourable tumor stage in pancreatic cancer patients.
12637154 ErbB4 signaling is growth inhibitory and may be coupled to tumor suppression in prostate cells
12528817 ErbB4 is specifically associated with neuritic plaques in the hippocampus of Alzheimer disease patients.
12454007 deletion of the PDZ domain recognition motif does abrogate the gamma-secretase cleavage of ErbB-4
12297288 ErbB4 expression was observed through all stages of chondrocytic differentiation in vitro.
11679632 cleavage by gamma-secretase releases the ErbB-4 intracellular domain from the membrane and facilitates its translocation to the nucleus

AA Sequence

MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH      1 - 70
NRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT     71 - 140
EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR    141 - 210
TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN    211 - 280
AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS    281 - 350
SNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL    351 - 420
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN    421 - 490
RKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCE    491 - 560
KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTS    561 - 630
HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTP    631 - 700
SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL    701 - 770
IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV    771 - 840
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI    841 - 910
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD    911 - 980
PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGH    981 - 1050
SPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQ   1051 - 1120
EDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHN   1121 - 1190
ASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ   1191 - 1260
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV                         1261 - 1308
//

Text Mined References (272)

PMID Year Title
27069134 2016 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study.
26907936 2016 Prognostic value of ERBB4 expression in patients with triple negative breast cancer.
26886748 2016 Hepatitis C Virus Activates a Neuregulin-Driven Circuit to Modify Surface Expression of Growth Factor Receptors of the ErbB Family.
26780728 2016 Development of an ErbB4 monoclonal antibody that blocks neuregulin-1-induced ErbB4 activation in cancer cells.
26701850 2016 Genetic variants in ERBB4 is associated with chronic hepatitis B virus infection.
26648299 2015 [Neuregulin-1 promotes proliferation and migration of human coronary artery smooth muscle cells by enhancing its receptor phosphorylation].
26535009 2015 Neuregulin-activated ERBB4 induces the SREBP-2 cholesterol biosynthetic pathway and increases low-density lipoprotein uptake.
26463425 2016 Identification of a new subclass of ALK-negative ALCL expressing aberrant levels of ERBB4 transcripts.
26418945 2016 ErbB4 Activated p38? MAPK Isoform Mediates Early Cardiogenesis Through NKx2.5 in Human Pluripotent Stem Cells.
26365191 2015 Defined MicroRNAs Induce Aspects of Maturation in Mouse and Human Embryonic-Stem-Cell-Derived Cardiomyocytes.
26337038 2016 Dysregulated ErbB4 Splicing in Schizophrenia: Selective Effects on Parvalbumin Expression.
26238412 2015 HER4 tumor expression in breast cancer patients randomized to treatment with or without tamoxifen.
26050618 2016 Activating ERBB4 mutations in non-small cell lung cancer.
26021752 2015 Evaluation of the prognostic significance of HER family mRNA expression in high-risk early breast cancer: a Hellenic Cooperative Oncology Group (HeCOG) validation study.
25916654 2015 ERBB4 is over-expressed in human colon cancer and enhances cellular transformation.
25744101 2015 ERBB4 polymorphism and family history of psychiatric disorders on age-related cortical changes in healthy children.
25740878 2015 Trophoblast subtype-specific EGFR/ERBB4 expression correlates with cell cycle progression and hyperplasia in complete hydatidiform moles.
25731189 2015 Protein expression of HER2, 3, 4 in gastric cancer: correlation with clinical features and survival.
25516216 2014 Overexpression of ERBB4 JM-a CYT-1 and CYT-2 isoforms in transgenic mice reveals isoform-specific roles in mammary gland development and carcinogenesis.
25492965 2014 Neuregulin 1-activated ERBB4 interacts with YAP to induce Hippo pathway target genes and promote cell migration.
25492964 2014 Neuregulin 1-activated ERBB4 as a "dedicated" receptor for the Hippo-YAP pathway.
25468910 2015 Kinase activator-receiver preference in ErbB heterodimers is determined by intracellular regions and is not coupled to extracellular asymmetry.
25416285 2014 Localization of phosphorylated ErbB1-4 and heregulin in colorectal cancer.
25391651 2015 miR-193a-3p functions as a tumor suppressor in lung cancer by down-regulating ERBB4.
25335735 2014 Genetic variation of ErbB4 confers risk of colorectal cancer in a Chinese Han population.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25216938 2014 The ErbB4 ligand neuregulin-4 protects against experimental necrotizing enterocolitis.
25142529 2014 No association between NRG1 and ErbB4 genes and psychopathological symptoms of schizophrenia.
25140053 2014 The ErbB4 CYT2 variant protects EGFR from ligand-induced degradation to enhance cancer cell motility.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25036186 2014 ERBB4 promoter polymorphism is associated with poor distant disease-free survival in high-risk early breast cancer.
25003574 2014 The localization of HER4 intracellular domain and expression of its alternately-spliced isoforms have prognostic significance in ER+ HER2- breast cancer.
24927194 2014 Characterization of EGFR family gene aberrations in cholangiocarcinoma.
24901400 2014 High incidence of ErbB3, ErbB4, and MET expression in ovarian cancer.
24893630 2014 An unconventional KITENIN/ErbB4-mediated downstream signal of EGF upregulates c-Jun and the invasiveness of colorectal cancer cells.
24862237 2015 Absence of EGFR, ERBB2 and ERBB4 mutation homologous to the oncogenic ERBB3 Val-104 mutation in colorectal cancers.
24829397 2014 Convergent and divergent cellular responses by ErbB4 isoforms in mammary epithelial cells.
24824216 2014 Genome-wide interaction studies reveal sex-specific asthma risk alleles.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24636039 2014 Elevated ErbB4 mRNA is related to interneuron deficit in prefrontal cortex in schizophrenia.
24557338 2014 Characterisation of HER heterodimers in breast cancer using in situ proximity ligation assay.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24469061 2015 MicroRNA-193a-3p and -5p suppress the metastasis of human non-small-cell lung cancer by downregulating the ERBB4/PIK3R3/mTOR/S6K2 signaling pathway.
24438167 2014 miR-302b is a potential molecular marker of esophageal squamous cell carcinoma and functions as a tumor suppressor by targeting ErbB4.
24366194 2014 HER4 and its cytoplasmic isoforms are associated with progression-free survival of malignant melanoma.
24338375 2014 Cooverexpression of ERBB1 and ERBB4 receptors predicts poor clinical outcome in pN+ oral squamous cell carcinoma with extranodal spread.
24333426 2014 HER4 selectively coregulates estrogen stimulated genes associated with breast tumor cell proliferation.
24318637 2013 Molecular modeling of ErbB4/HER4 kinase in the context of the HER4 signaling network helps rationalize the effects of clinically identified HER4 somatic mutations on the cell phenotype.
24308844 2013 Molecular origin of the binding of WWOX tumor suppressor to ErbB4 receptor tyrosine kinase.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
24119685 2013 ERBB4 mutations that disrupt the neuregulin-ErbB4 pathway cause amyotrophic lateral sclerosis type 19.
24063248 2013 The prognostic value of Her4 receptor isoform expression in triple-negative and Her2 positive breast cancer patients.
24015958 2013 The HER4 isoform JM-a/CYT2 relates to improved survival in bladder cancer patients but only if the estrogen receptor ? is not expressed.
23999525 2014 Evidence from mouse and man for a role of neuregulin 3 in nicotine dependence.
23991224 2013 Inverse regulation of EGFR/HER1 and HER2-4 in normal and malignant human breast tissue.
23927961 2013 Genetic variations in EGFR and ERBB4 increase susceptibility to cervical cancer.
23903073 2013 Genome-wide association study of the five-factor model of personality in young Korean women.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23723069 2013 Leucine-rich repeat and immunoglobulin domain-containing protein-1 (Lrig1) negative regulatory action toward ErbB receptor tyrosine kinases is opposed by leucine-rich repeat and immunoglobulin domain-containing protein 3 (Lrig3).
23681745 2013 ERBB4 confers metastatic capacity in Ewing sarcoma.
23543049 2013 Replication study for the association of 3 SNP loci identified in a genome-wide association study for diabetic nephropathy in European type 1 diabetes with diabetic nephropathy in Japanese patients with type 2 diabetes.
23432624 2013 Immunohistochemical analysis of the monoclonal antibody 4B5 in breast tissue expressing human epidermal growth factor receptor 4 (HER4).
23395558 2013 Expression and potential role of ErbB receptors in type II endometrial cancer.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23340734 2013 Mutations in ERBB4 may have a minor role in melanoma pathogenesis.
23333248 2013 ErbB receptor tyrosine kinase family expression levels in urothelial bladder carcinoma.
23313737 2013 CYT-1 isoform of ErbB4 is an independent prognostic factor in serous ovarian cancer and selectively promotes ovarian cancer cell growth in vitro.
23301017 2013 Discovery, validation and characterization of Erbb4 and Nrg1 haplotypes using data from three genome-wide association studies of schizophrenia.
23237222 2013 The absence of the ERBB4 hotspot mutations in melanomas in patients from southern China.
23230144 2013 Nuclear ErbB4 signaling through H3K9me3 is antagonized by EGFR-activated c-Src.
23137868 Expression of epidermal growth factors and a tight junction protein in the nasal mucosa of patients with chronic hypertrophic rhinitis.
23123776 2012 Neuregulin-1 receptor tyrosine kinase ErbB4 is upregulated in midbrain dopaminergic neurons in Parkinson disease.
23100016 2014 Association of ErbB1-4 expression in invasive breast cancer with clinicopathological characteristics and prognosis.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22891299 2012 Dynamically varying interactions between heregulin and ErbB proteins detected by single-molecule analysis in living cells.
22854050 2012 Activated HER-receptors in predicting outcome of ER-positive breast cancer patients treated with adjuvant endocrine therapy.
22761786 2012 Proteolytic processing of ErbB4 in breast cancer.
22739235 2012 Neuregulin-1 exerts protective effects against neurotoxicities induced by C-terminal fragments of APP via ErbB4 receptor.
22699492 2012 A single ligand is sufficient to activate EGFR dimers.
22634065 2012 Genetic association analysis of ERBB4 polymorphisms with the risk of schizophrenia and SPEM abnormality in a Korean population.
22606006 2012 Frequent gene amplification predicts poor prognosis in gastric cancer.
22584572 2012 Protein inhibitor of activated STAT3 (PIAS3) protein promotes SUMOylation and nuclear sequestration of the intracellular domain of ErbB4 protein.
22554477 2012 Gene expression pattern of the epidermal growth factor receptor family and LRIG1 in renal cell carcinoma.
22549119 2012 A common variant in ERBB4 regulates GABA concentrations in human cerebrospinal fluid.
22504067 2012 Neuregulin-1/ErbB4 signaling controls the migration of oligodendrocyte precursor cells during development.
22452962 2012 A genome-wide association study identifies a breast cancer risk variant in ERBB4 at 2q34: results from the Seoul Breast Cancer Study.
22415601 2012 Slow down to stay alive: HER4 protects against cellular stress and confers chemoresistance in neuroblastoma.
22378872 2012 The importance of the NRG-1/ErbB4 pathway for synaptic plasticity and behaviors associated with psychiatric disorders.
22327010 2012 Expression of epidermal growth factors, erbBs, in the nasal mucosa of patients with chronic hypertrophic rhinitis.
22308027 2012 Interaction with ErbB4 promotes hypoxia-inducible factor-1? signaling.
22294845 2012 A polymorphism within ErbB4 is associated with risk for hepatocellular carcinoma in Chinese population.
22115776 2013 Schizophrenia candidate gene ERBB4: covert routes of vulnerability to psychosis detected at the population level.
22012915 2012 The ErbB4 extracellular region retains a tethered-like conformation in the absence of the tether.
21993442 2012 Analysis of association between common SNPs in ErbB4 and bipolar affective disorder, major depressive disorder and schizophrenia in the Han Chinese population.
21832192 2011 Genetic association of ErbB4 and human cortical GABA levels in vivo.
21811097 2011 Function of ERBB4 is determined by alternative splicing.
21805036 The role of neuregulin4 and HER4 in gastrointestinal malignant lymphoma.
21664604 2011 Conserved interneuron-specific ErbB4 expression in frontal cortex of rodents, monkeys, and humans: implications for schizophrenia.
21637803 2011 Exonic DNA sequencing of ERBB4 in bipolar disorder.
21547347 2011 No evidence for ErbB4 gene amplification in malignant melanoma.
21439954 2011 Small tyrosine kinase inhibitors interrupt EGFR signaling by interacting with erbB3 and erbB4 in glioblastoma cell lines.
21422241 2011 Carboxyl-group footprinting maps the dimerization interface and phosphorylation-induced conformational changes of a membrane-associated tyrosine kinase.
21407808 2011 Alternative HER/PTEN/Akt pathway activation in HPV positive and negative penile carcinomas.
21290564 2011 Association of common variants in ERBB4 with congenital left ventricular outflow tract obstruction defects.
21233683 2011 Mutational analysis of the extracellular domain of ERBB4 gene in common carcinomas.
21232925 2011 Genetic variants in the ErbB4 gene are associated with white matter integrity.
21217148 2011 Spatiotemporally-regulated interaction between ?1 integrin and ErbB4 that is involved in fibronectin-dependent cell migration.
21203803 2011 Expression and significance of HER family receptors in neuroblastic tumors.
20975381 2010 Analysis of ERBB4 mutations and expression in japanese patients with lung cancer.
20933198 2010 Neuregulin-1/ErbB signaling and chronic heart failure.
20921115 2010 Biological validation of increased schizophrenia risk with NRG1, ERBB4, and AKT1 epistasis via functional neuroimaging in healthy controls.
20886074 2010 Molecular cloning and characterization of the human ErbB4 gene: identification of novel splice isoforms in the developing and adult brain.
20881644 2010 Somatic mutations in epidermal growth factor receptor signaling pathway genes in non-small cell lung cancers.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603612 2010 Reactivation of epigenetically silenced HER4/ERBB4 results in apoptosis of breast tumor cells.
20600594 2010 Support for the involvement of the ERBB4 gene in schizophrenia: a genetic association analysis.
20585313 2010 ErbB4 promotes cyclooxygenase-2 expression and cell survival in colon epithelial cells.
20550710 2010 The ERalpha coactivator, HER4/4ICD, regulates progesterone receptor expression in normal and malignant breast epithelium.
20446891 2010 A comprehensive study of the association between the EGFR and ERBB2 genes and glioma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20303366 2010 ErbB4 regulates the timely progression of late fetal lung development.
20227043 2010 An activated ErbB3/NRG1 autocrine loop supports in vivo proliferation in ovarian cancer cells.
20204273 2010 Expression of the HER-1-4 family of receptor tyrosine kinases in neuroendocrine tumours.
20022944 2010 Her4 and Her2/neu tyrosine kinase domains dimerize and activate in a reconstituted in vitro system.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19808643 2009 Subcellular localization of the HER4 intracellular domain, 4ICD, identifies distinct prognostic outcomes for breast cancer patients.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19718025 2009 Analysis of the tyrosine kinome in melanoma reveals recurrent mutations in ERBB4.
19624808 2009 Presence of HER4 associates with increased sensitivity to Herceptin in patients with metastatic breast cancer.
19609946 2010 Endocrine resistance associated with activated ErbB system in breast cancer cells is reversed by inhibiting MAPK or PI3K/Akt signaling pathways.
19596786 2009 ErbB4 splice variants Cyt1 and Cyt2 differ by 16 amino acids and exert opposing effects on the mammary epithelium in vivo.
19561640 2009 WW domain containing E3 ubiquitin protein ligase 1 targets the full-length ErbB4 for ubiquitin-mediated degradation in breast cancer.
19481955 2010 The upgraded role of HER3 and HER4 receptors in breast cancer.
19447869 2009 Analysis of ErbB receptors in pulmonary carcinoid tumors.
19439407 2009 Transcriptional interaction of an estrogen receptor splice variant and ErbB4 suggests convergence in gene susceptibility pathways in schizophrenia.
19390858 2009 ErbB family immunohistochemical expression in colorectal cancer patients with higher risk of recurrence after radical surgery.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19263517 2009 ErbB2 and ErbB4 Cbl binding sites can functionally replace the ErbB1 Cbl binding site.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19193720 2009 Nedd4 mediates ErbB4 JM-a/CYT-1 ICD ubiquitination and degradation in MDCK II cells.
19171023 2009 Removal of cell surface heparan sulfate increases TACE activity and cleavage of ErbB4 receptor.
19148499 2009 Expression of heregulin, phosphorylated HER-2, HER-3 and HER-4 in HER-2 negative breast cancers.
19098003 2009 Somatic mutations of ErbB4: selective loss-of-function phenotype affecting signal transduction pathways in cancer.
19017278 2009 Real-time quantitative polymerase chain reaction (qPCR) analysis with fluorescence resonance energy transfer (FRET) probes reveals differential expression of the four ERBB4 juxtamembrane region variants between medulloblastoma and pilocytic astrocytoma.
18985033 2008 Evaluation of the prognostic and predictive value of HER family mRNA expression in high-risk early breast cancer: a Hellenic Cooperative Oncology Group (HeCOG) study.
18973758 2009 The ErbB4 growth factor receptor is required for colon epithelial cell survival in the presence of TNF.
18721752 2008 System-wide investigation of ErbB4 reveals 19 sites of Tyr phosphorylation that are unusually selective in their recruitment properties.
18668031 2009 ErbB4 genotype predicts left frontotemporal structural connectivity in human brain.
18662768 2008 Specific developmental reductions in subventricular zone ErbB1 and ErbB4 mRNA in the human brain.
18473151 2008 HER4 intracellular domain (4ICD) activity in the developing mammary gland and breast cancer.
18454307 2008 Role of ErbB4 in breast cancer.
18437540 2008 ErbB4/HER4: role in mammary gland development, differentiation and growth inhibition.
18424286 2008 Evaluation of type 1 growth factor receptor family expression in benign and malignant thyroid lesions.
18335053 2008 Topological analysis of MAPK cascade for kinetic ErbB signaling.
18334220 2008 Mechanism of activation and inhibition of the HER4/ErbB4 kinase.
18287036 2008 6-Ethynylthieno[3,2-d]- and 6-ethynylthieno[2,3-d]pyrimidin-4-anilines as tunable covalent modifiers of ErbB kinases.
18182100 2008 Cytogenetic analysis of HER1/EGFR, HER2, HER3 and HER4 in 278 breast cancer patients.
18094435 2007 A novel polymorphism in the promoter region of ERBB4 is associated with breast and colorectal cancer risk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17969526 2007 [Expression and significance of ErbB3 and ErbB4 in patients with laryngeal squamous cell carcinomas].
17945187 2007 Inter-conversion of neuregulin2 full and partial agonists for ErbB4.
17909041 2007 Association of Wwox with ErbB4 in breast cancer.
17903305 2007 A genome-wide association study of breast and prostate cancer in the NHLBI's Framingham Heart Study.
17761534 2007 ErbB4 isoforms selectively regulate growth factor induced Madin-Darby canine kidney cell tubulogenesis.
17681096 2007 ErbB4 expression and mutation in Japanese patients with lung cancer.
17638867 2007 HER4 D-box sequences regulate mitotic progression and degradation of the nuclear HER4 cleavage product s80HER4.
17598910 2007 Interactions among genes in the ErbB-Neuregulin signalling network are associated with increased susceptibility to schizophrenia.
17505063 2007 The HER4 cytoplasmic domain, but not its C terminus, inhibits mammary cell proliferation.
17487277 2007 Mutational analysis of EGFR and related signaling pathway genes in lung adenocarcinomas identifies a novel somatic kinase domain mutation in FGFR4.
17486069 2007 Differential nuclear localization and kinase activity of alternative ErbB4 intracellular domains.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17177598 2006 Epidermal growth factor receptor activation in glioblastoma through novel missense mutations in the extracellular domain.
17164265 2007 Disease-associated intronic variants in the ErbB4 gene are related to altered ErbB4 splice-variant expression in the brain in schizophrenia.
17120616 2006 Phosphorylation of ErbB4 on tyrosine 1056 is critical for ErbB4 coupling to inhibition of colony formation by human mammary cell lines.
17018285 2006 Presenilin-dependent ErbB4 nuclear signaling regulates the timing of astrogenesis in the developing brain.
16978839 2007 Neuregulin-1 only induces trans-phosphorylation between ErbB receptor heterodimer partners.
16934755 2006 Phosphorylation of ErbB4 on Tyr1056 is critical for inhibition of colony formation by prostate tumor cell lines.
16914727 2006 Heregulin-dependent delay in mitotic progression requires HER4 and BRCA1.
16912174 2006 Coregulation of estrogen receptor by ERBB4/HER4 establishes a growth-promoting autocrine signal in breast tumor cells.
16891421 2006 Convergent evidence that oligodendrocyte lineage transcription factor 2 (OLIG2) and interacting genes influence susceptibility to schizophrenia.
16878160 2006 Alternative splicing of the ErbB-4 cytoplasmic domain and its regulation by hedgehog signaling identify distinct medulloblastoma subsets.
16842254 2006 Expression of c-erbB-4 in medulloblastoma and its correlation with prognosis.
16837552 2006 The intracellular domain of ErbB4 induces differentiation of mammary epithelial cells.
16832345 2007 A constitutively active ERBB4/HER4 allele with enhanced transcriptional coactivation and cell-killing activities.
16819515 2007 ErbB4 (JM-b/CYT-1)-induced expression and phosphorylation of c-Jun is abrogated by human papillomavirus type 16 E5 protein.
16815842 2006 ErbB-4 s80 intracellular domain abrogates ETO2-dependent transcriptional repression.
16778220 2006 The ERBB4/HER4 intracellular domain 4ICD is a BH3-only protein promoting apoptosis of breast cancer cells.
16767099 2006 Altered neuregulin 1-erbB4 signaling contributes to NMDA receptor hypofunction in schizophrenia.
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16685269 2006 The relation between survival and expression of HER1 and HER2 depends on the expression of HER3 and HER4: a study in bladder cancer patients.
16606438 2006 HER4 in breast cancer: comparison of antibodies against intra- and extra-cellular domains of HER4.
16518842 2006 Ligand-independent regulation of ErbB4 receptor phosphorylation by activated Ras.
16477370 2006 Expression of the ErbB4 receptor causes reversal regulation of PP2A in the Shc signal transduction pathway in human cancer cells.
16463386 2006 ErbB4 increases the proliferation potential of human lung cancer cells and its blockage can be used as a target for anti-cancer therapy.
16428439 2006 Essential role for Rac in heregulin beta1 mitogenic signaling: a mechanism that involves epidermal growth factor receptor and is independent of ErbB4.
16402353 2006 The involvement of ErbB4 with schizophrenia: association and expression studies.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16251361 2006 Proteolytic cleavage and phosphorylation of a tumor-associated ErbB4 isoform promote ligand-independent survival and cancer cell growth.
16249994 2006 Evidence that interaction between neuregulin 1 and its receptor erbB4 increases susceptibility to schizophrenia.
16203964 2005 The extracellular region of ErbB4 adopts a tethered conformation in the absence of ligand.
16187281 2006 Somatic mutations of the ERBB4 kinase domain in human cancers.
16170367 2006 The ErbB-4 s80 intracellular domain is a constitutively active tyrosine kinase.
16061658 2005 WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.
15985438 2005 Secretase-dependent tyrosine phosphorylation of Mdm2 by the ErbB-4 intracellular domain fragment.
15979989 2005 Gene expression and immunolocalization of heparin-binding epidermal growth factor-like growth factor and human epidermal growth factor receptors in human corpus luteum.
15944951 2005 The diverse signaling network of EGFR, HER2, HER3 and HER4 tyrosine kinase receptors and the consequences for therapeutic approaches.
15863494 2005 ERBB4/HER4 potentiates STAT5A transcriptional activity by regulating novel STAT5A serine phosphorylation events.
15788662 2005 Absence of HER4 expression predicts recurrence of ductal carcinoma in situ of the breast.
15746097 2005 Presenilin-dependent gamma-secretase processing regulates multiple ERBB4/HER4 activities.
15735025 2005 Cleavable ErbB4 isoform in estrogen receptor-regulated growth of breast cancer cells.
15685397 2005 Neuregulin receptors erbB2 and erbB4 in failing human myocardium -- depressed expression and attenuated activation.
15562026 2005 Heparin-binding epidermal growth factor and its receptors mediate decidualization and potentiate survival of human endometrial stromal cells.
15534001 2004 The ERBB4/HER4 receptor tyrosine kinase regulates gene expression by functioning as a STAT5A nuclear chaperone.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15248827 2004 Changes in the expression and cytological localization of betacellulin and its receptors (ErbB-1 and ErbB-4) in the trophoblasts in human placenta over the course of pregnancy.
15084248 2004 Outcome and human epidermal growth factor receptor (HER) 1-4 status in invasive breast carcinomas with proliferation indices evaluated by bromodeoxyuridine labelling.
15026342 2004 Cell surface expression of epidermal growth factor receptor and Her-2 with nuclear expression of Her-4 in primary osteosarcoma.
15023535 2004 Ligand-regulated association of ErbB-4 to the transcriptional co-activator YAP65 controls transcription at the nuclear level.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504474 ErbB4 signaling during breast and neural development: novel genetic models reveal unique ErbB4 activities.
12939402 2003 Heregulin targets gamma-catenin to the nucleolus by a mechanism dependent on the DF3/MUC1 oncoprotein.
12869563 2003 Ectodomain cleavage of ErbB-4: characterization of the cleavage site and m80 fragment.
12807903 2003 WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.
12678544 2001 Comparative analysis of the EGF-receptor family in pancreatic cancer: expression of HER-4 correlates with a favourable tumor stage.
12648466 2003 ErbB-4: mechanism of action and biology.
12646923 2003 Segregation of receptor and ligand regulates activation of epithelial growth factor receptor.
12637154 2003 A constitutively active ErbB4 mutant inhibits drug-resistant colony formation by the DU-145 and PC-3 human prostate tumor cell lines.
12532415 2003 Spontaneous activation and signaling by overexpressed epidermal growth factor receptors in glioblastoma cells.
12528817 2003 Neuregulin-1 and erbB4 immunoreactivity is associated with neuritic plaques in Alzheimer disease brain and in a transgenic model of Alzheimer disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454007 2003 Role of the ErbB-4 carboxyl terminus in gamma-secretase cleavage.
12297288 2002 Tyrosine kinase-type receptor ErbB4 in chondrocytes: interaction with connective tissue growth factor and distribution in cartilage.
12175853 Compartmentalized NRG signaling and PDZ domain-containing proteins in synapse structure and function.
11867753 2002 An RBCC protein implicated in maintenance of steady-state neuregulin receptor levels.
11825873 2002 CD44 anchors the assembly of matrilysin/MMP-7 with heparin-binding epidermal growth factor precursor and ErbB4 and regulates female reproductive organ remodeling.
11741961 2002 Presenilin-dependent gamma-secretase-like intramembrane cleavage of ErbB4.
11390655 2001 Her4 mediates ligand-dependent antiproliferative and differentiation responses in human breast cancer cells.
11278868 2001 Transgenic MUC1 interacts with epidermal growth factor receptor and correlates with mitogen-activated protein kinase activation in the mouse mammary gland.
11254912 2001 Immunohistochemical localization of Betacellulin, a member of epidermal growth factor family, in atherosclerotic plaques of human aorta.
11178955 2001 BIBX1382BS, but not AG1478 or PD153035, inhibits the ErbB kinases at different concentrations in intact cells.
10918572 2000 Unique carboxyl-terminal sequences of wild type and alternatively spliced variant forms of transforming growth factor-alpha precursors mediate specific interactions with ErbB4 and ErbB2.
10867024 2000 Ligand discrimination in signaling through an ErbB4 receptor homodimer.
10744726 2000 Tumor necrosis factor-alpha-converting enzyme is required for cleavage of erbB4/HER4.
10725395 2000 The neuregulin receptor ErbB-4 interacts with PDZ-containing proteins at neuronal synapses.
10722704 2000 A natural ErbB4 isoform that does not activate phosphoinositide 3-kinase mediates proliferation but not survival or chemotaxis.
10572067 1999 Dominance of ErbB-1 heterodimers in lung epithelial cells overexpressing ErbB-2. Both ErbB-1 and ErbB-2 contribute significantly to tumorigenicity.
10537356 1999 Expression of the c-erbB-3/HER-3 and c-erbB-4/HER-4 growth factor receptors and their ligands, neuregulin-1 alpha, neuregulin-1 beta, and betacellulin, in normal endometrium and endometrial cancer.
10358079 1999 ErbB receptor-induced activation of stat transcription factors is mediated by Src tyrosine kinases.
10353604 1999 Characterization of a naturally occurring ErbB4 isoform that does not bind or activate phosphatidyl inositol 3-kinase.
10348342 1999 Neuregulin-4: a novel growth factor that acts through the ErbB-4 receptor tyrosine kinase.
9771476 1998 Expression of the c-erbB-4/HER4 protein and mRNA in normal human fetal and adult tissues and in a survey of nine solid tumour types.
9565587 1998 Binding interaction of the heregulinbeta egf domain with ErbB3 and ErbB4 receptors assessed by alanine scanning mutagenesis.
9516479 1998 Analysis of Grb7 recruitment by heregulin-activated erbB receptors reveals a novel target selectivity for erbB3.
9419975 1997 Epiregulin binds to epidermal growth factor receptor and ErbB-4 and induces tyrosine phosphorylation of epidermal growth factor receptor, ErbB-2, ErbB-3 and ErbB-4.
9334263 1997 A novel juxtamembrane domain isoform of HER4/ErbB4. Isoform-specific tissue distribution and differential processing in response to phorbol ester.
9275162 1997 Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4.
9230911 1997 Expression patterns of erbB receptor family in normal urothelium and transitional cell carcinoma. An immunohistochemical study.
9168115 1997 Neuregulin-2, a new ligand of ErbB3/ErbB4-receptor tyrosine kinases.
9168114 1997 Ligands for ErbB-family receptors encoded by a neuregulin-like gene.
9135143 1997 Activation of HER4 by heparin-binding EGF-like growth factor stimulates chemotaxis but not proliferation.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8617750 1996 HER4-mediated biological and biochemical properties in NIH 3T3 cells. Evidence for HER1-HER4 heterodimers.
8570211 1996 Betacellulin activates the epidermal growth factor receptor and erbB-4, and induces cellular response patterns distinct from those stimulated by epidermal growth factor or neuregulin-beta.
8383326 1993 Ligand-specific activation of HER4/p180erbB4, a fourth member of the epidermal growth factor receptor family.
8062828 1994 Solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erbB-4.
7902537 1993 Heregulin induces tyrosine phosphorylation of HER4/p180erbB4.
7721889 1995 The structural basis for the specificity of epidermal growth factor and heregulin binding.
7700649 1995 Localization of the human HER4/erbB-4 gene to chromosome 2.
7689552 1993 Characterization of a breast cancer cell differentiation factor that specifically activates the HER4/p180erbB4 receptor.