Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1757.53
PubTator Score 118.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 1.3e-05

Gene RIF (16)

PMID Text
25940089 N-terminal extension of E-RAS is important for E-RAS signaling activity.
25624498 Expression of ERAS in human melanoma cell lines conferred resistance to PLX4720 and induced hyperphosphorylation of AKT.
23612786 After knocking down the ERas gene by siRNA, we observed that there was a significant decrease in proliferation, metastasis as well as clonality in gastric carcinoma.
22875024 Data indicate that expression of ERAS, LHX1, and CCRK is increased in aggressive subgroups of medulloblastomas.
21151392 ERas may be a potential biomarker for gastric cancer, but advanced studies are wanted.
20811723 ERas/PI3K pathway may provide resistance to chemotherapy and promote transforming activity in neuroblastoma.
20566745 These data suggest that ERas is activated in a significant population of gastric cancer, where it may play a crucial role in gastric cancer cell survival and metastases to liver via down-regulation of E-cadherin.
19787253 Loss of methylation in the promoter of ERas might be one of mechanisms responsible for the re-expression of an embryonic oncogene in gastric cancer.
19528480 High ERas is associated with the tumorigenic process of gastric carcinomas.
18174262 rasH2 may have a role in susceptibility to chemically-induced tongue and esophageal neoplasms
17940286 Knocking down oxidase Nox4 completely suppresses Tat-dependent Ras and ERK activation downstream of Rac1 and RhoA and blocks Tat-dependent proliferation
16436505 Knocking down oxidase Nox4 completely suppresses Tat-dependent Ras and ERK activation downstream of Rac1 and RhoA and blocks Tat-dependent proliferation
16081664 Studies on ERas gene expression.
12774123 transforming oncogene ERas is important in the tumour-like growth properties of embryonic stem cells
9344703 Knocking down oxidase Nox4 completely suppresses Tat-dependent Ras and ERK activation downstream of Rac1 and RhoA and blocks Tat-dependent proliferation
9269777 Knocking down oxidase Nox4 completely suppresses Tat-dependent Ras and ERK activation downstream of Rac1 and RhoA and blocks Tat-dependent proliferation

AA Sequence

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH      1 - 70
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP     71 - 140
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP    141 - 210
MARSCREKTRHQKATCHCGCSVA                                                   211 - 233
//

Text Mined References (18)

PMID Year Title
25940089 2015 The Function of Embryonic Stem Cell-expressed RAS (E-RAS), a Unique RAS Family Member, Correlates with Its Additional Motifs and Its Structural Properties.
25624498 2015 BRAF inhibitor resistance mediated by the AKT pathway in an oncogenic BRAF mouse melanoma model.
23612786 2013 Role of the ERas gene in gastric cancer cells.
22875024 2012 Functional genomics identifies drivers of medulloblastoma dissemination.
21965746 2011 ERas enhances resistance to CPT-11 in gastric cancer.
21205089 2011 Identification of HLA-A*2402-restricted epitope peptide derived from ERas oncogene expressed in human scirrhous gastric cancer.
21151392 2010 Detection of ?-catenin, gastrokine-2 and embryonic stem cell expressed ras in gastric cancers.
20811723 2010 Resistance to chemotherapeutic agents and promotion of transforming activity mediated by embryonic stem cell-expressed Ras (ERas) signal in neuroblastoma cells.
20566745 2010 Role of ES cell-expressed Ras (ERas) in tumorigenicity of gastric cancer.
19787253 2009 Epigenetic regulation of the embryonic oncogene ERas in gastric cancer cells.
19528480 2009 Expression of ERas oncogene in gastric carcinoma.
18225573 ERas oncogene expression and epigenetic regulation by histone acetylation in human cancer cells.
18174262 2008 A novel rasH2 mouse carcinogenesis model that is highly susceptible to 4-NQO-induced tongue and esophageal carcinogenesis is useful for preclinical chemoprevention studies.
16081664 Human ERas gene has an upstream premature polyadenylation signal that results in a truncated, noncoding transcript.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12774123 2003 Role of ERas in promoting tumour-like properties in mouse embryonic stem cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
6322122 1984 The human c-Ha-ras2 is a processed pseudogene inactivated by numerous base substitutions.