Property Summary

NCBI Gene PubMed Count 44
PubMed Score 46.00
PubTator Score 51.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 2.100 1.9e-02
interstitial lung disease 2.400 2.1e-02
malignant mesothelioma 2.000 3.5e-07
astrocytic glioma 1.300 4.1e-02
ependymoma 2.800 7.5e-08
oligodendroglioma 1.600 2.9e-02
esophageal adenocarcinoma 1.200 3.5e-02
cutaneous lupus erythematosus 1.100 6.3e-03
psoriasis 1.400 3.1e-04
glioblastoma 2.900 1.7e-03
osteosarcoma -2.096 2.3e-02
sonic hedgehog group medulloblastoma 1.700 1.9e-04
atypical teratoid/rhabdoid tumor 1.400 5.8e-04
primitive neuroectodermal tumor 2.300 2.2e-02
juvenile dermatomyositis 1.086 2.6e-08
tuberculosis 1.600 8.5e-03
lung cancer -1.200 1.7e-03
pediatric high grade glioma 2.700 5.8e-05
pilocytic astrocytoma 3.000 6.0e-08
primary Sjogren syndrome 1.900 1.8e-03
lung carcinoma -1.300 8.9e-06
acute myeloid leukemia 2.600 4.8e-02
ovarian cancer 1.800 2.7e-02
head and neck cancer and chronic obstruc... 1.700 2.1e-02

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
743319 confirmatory 61 / 1 / 89 MLPCN ERAP2 Measured in Biochemical System Using Plate Reader - 7016-02_Inhibitor_Dose_CherryPick_Activity
743320 confirmatory 2 / 0 / 149 MLPCN ERAP2 Measured in Biochemical System Using Plate Reader - 7016-02_Inhibitor_Dose_CherryPick_Activity_Set2

Gene RIF (35)

PMID Text
27384923 Increased expression of ERAP2 in GC-responders before therapy warrants further investigation into their role as potential predictors for the response to GC, and in the inflammatory process of rheumatoid arthritis.
26148615 ERAP2 might be associated with CLNM in PTMC.
26088389 ERAP2 variation does not have a significant effect on PBMC intracellular and cell surface HLA-class I expression and heavy chain formation, markers of ER stress or inflammatory cytokine production.
25917849 ERAP2 is associated with ankylosing spondylitis in HLA-B27 positive and HLA-B27 negative patients.
25142031 Studies indicate the critical role of M1 aminopeptidases ERAP1, ERAP2 and NPEPPS in immune-mediated diseases.
24957906 The risk allele of the polymorphism near ERAP2 is strongly associated with birdshot chorioretinopathy.
24928998 Data indicate that dimerization of endoplasmic reticulum aminopeptidases ERAP1/2 creates complexes with superior peptide-trimming efficacy.
24223975 concerted aminoproteolytic activity of ERAP 1 and ERAP2
23988446 The association and co-localization of ERAP2 and EpCAM at the surface of breast cancer cells is a unique and novel finding that provides new ideas on EpCAM processing and on how antigen presentation may be regulated in cancer.
23696916 ERAP1 and ERAP2 might be involved in the development of immune escape mechanisms of renal cell carcinoma.
23545452 Generation and destruction of antigenic peptides by endoplasmic reticulum resident aminopeptidases ERAP1 and ERAP2 have been shown in the last few years to be important for correct functioning and regulation of the adaptive immune response.
23435305 ERAP2 haplotype A is correlated with resistance to HIV-1 infection, possibly secondarily to its effect on antigen processing and presentation.
23435305 HIV-1 p24 levels in PBMC cultures are significantly lower in ERAP2 homoA compared with both homoB and heteroAB samples, suggesting homoA is correlated with resistance to HIV-1 infection
22837489 The common ERAP2 single nucleotide polymorphism rs2549782 that codes for amino acid variation Asp392Lys leads to alterations in both the activity and the specificity of the enzyme.
22505422 crystals of ERAP2 belonged to an orthorhombic space group and diffracted anisotropically to 3.3 A resolution in the best direction on an in-house X-ray source
22106953 The molecular structure of glycosylated human ERAP2 has been determined to 3.08 A resolution by molecular replacement using ERAP1 as a search model and refined.
21719416 assessed frequency of rs2248374 SNP in ERAP2 in ankylosing spondylitis (AS) cases and controls and found no association with AS
21569342 strong evidence that ERAP2 plays a role in the development of preeclampsia
21314638 S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
21299892 ERAP2 was found to have bimodal expression in human skeletal muscle tissue.
20976248 Data show that the differences between the ERAP2 splice forms provide important insights into the potential mechanism for the action of selection.
20843824 data suggest that genetic diversity in ERAP1 and ERAP2 has been maintained by balancing selection and that variants in ERAP2 confer resistance to HIV-1 infection possibly via the presentation of a distinctive peptide repertoire to CD8(+) T cells
20843824 Observational study of gene-disease association. (HuGE Navigator)
20595269 The ERAP1 and ERAP2 polymorphisms associated with ankylosing spondylitis (AS) do not influence the serum cytokine receptor levels in patients with AS.
20595269 Observational study of gene-disease association. (HuGE Navigator)
20419298 heterogeneous expression in melanoma cell lines
20103633 Data show the downregulation of MHC class I, ERAP1, and ERAP2 in aggressive NB cells is attributable to a low transcriptional availability of NF-kappaB, possibly due to an unknown suppressor other than MYCN.
19578876 Novel preeclampsia risk locus, ERAP2, in a region of known genetic linkage to this pregnancy-specific disorder.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19433412 Observational study of gene-disease association. (HuGE Navigator)
18393273 Results describe the altered expression of endoplasmic reticulum aminopeptidases ERAP1 and ERAP2 in transformed non-lymphoid human tissues.
18369178 ERAP2, which encodes an aminopeptidase, did not show preferential parent-of-origin expression, but rather, cis-acting nonimprinted differential allelic control
17129607 Dramatic genetic effect on LRAP expression.
16585582 low and/or imbalanced expression of ERAP1 and probably ERAP2 may cause improper Ag processing and favor tumor escape from immune surveillance
16054015 oxytocinase subfamily of M1 aminopeptidases play important roles in the maintenance of homeostasis including maintenance of normal pregnancy, memory retention, blood pressure regulation and antigen presentation [review]

AA Sequence

MFHSSAMVNSHRKPMFNIHRGFYCLTAILPQICICSQFSVPSSYHFTEDPGAFPVATNGERFPWQELRLP      1 - 70
SVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVL     71 - 140
SYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFYKSTYRTLGGETRILAVTDFEPTQARMAFPC    141 - 210
FDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSLSGFTSS    211 - 280
GVKVSIYASPDKRNQTHYALQASLKLLDFYEKYFDIYYPLSKLDLIAIPDFAPGAMENWGLITYRETSLL    281 - 350
FDPKTSSASDKLWVTRVIAHELAHQWFGNLVTMEWWNDIWLKEGFAKYMELIAVNATYPELQFDDYFLNV    351 - 420
CFEVITKDSLNSSRPISKPAETPTQIQEMFDEVSYNKGACILNMLKDFLGEEKFQKGIIQYLKKFSYRNA    421 - 490
KNDDLWSSLSNSCLESDFTSGGVCHSDPKMTSNMLAFLGENAEVKEMMTTWTLQKGIPLLVVKQDGCSLR    491 - 560
LQQERFLQGVFQEDPEWRALQERYLWHIPLTYSTSSSNVIHRHILKSKTDTLDLPEKTSWVKFNVDSNGY    561 - 630
YIVHYEGHGWDQLITQLNQNHTLLRPKDRVGLIHDVFQLVGAGRLTLDKALDMTYYLQHETSSPALLEGL    631 - 700
SYLESFYHMMDRRNISDISENLKRYLLQYFKPVIDRQSWSDKGSVWDRMLRSALLKLACDLNHAPCIQKA    701 - 770
AELFSQWMESSGKLNIPTDVLKIVYSVGAQTTAGWNYLLEQYELSMSSAEQNKILYALSTSKHQEKLLKL    771 - 840
IELGMEGKVIKTQNLAALLHAIARRPKGQQLAWDFVRENWTHLLKKFDLGSYDIRMIISGTTAHFSSKDK    841 - 910
LQEVKLFFESLEAQGSHLDIFQTVLETITKNIKWLEKNLPTLRTWLMVNT                        911 - 960
//

Text Mined References (49)

PMID Year Title
27384923 Expression of ERAP2 and LST1 is increased before start of therapy in rheumatoid arthritis patients with good clinical response to glucocorticoids.
26148615 Endoplasmic reticulum aminopeptidase 2 is highly expressed in papillary thyroid microcarcinoma with cervical lymph node metastasis.
26088389 2015 ERAP2 functional knockout in humans does not alter surface heavy chains or HLA-B27, inflammatory cytokines or endoplasmic reticulum stress markers.
25917849 2015 ERAP2 is associated with ankylosing spondylitis in HLA-B27-positive and HLA-B27-negative patients.
25142031 2014 Genetic associations and functional characterization of M1 aminopeptidases and immune-mediated diseases.
24957906 2014 A genome-wide association study identifies a functional ERAP2 haplotype associated with birdshot chorioretinopathy.
24928998 2014 ERAP1-ERAP2 dimerization increases peptide-trimming efficiency.
24223975 2013 Concerted in vitro trimming of viral HLA-B27-restricted ligands by human ERAP1 and ERAP2 aminopeptidases.
23988446 2013 EpCAM associates with endoplasmic reticulum aminopeptidase 2 (ERAP2) in breast cancer cells.
23696916 2013 Comparative expression profiling for human endoplasmic reticulum-resident aminopeptidases 1 and 2 in normal kidney versus distinct renal cell carcinoma subtypes.
23545452 2013 Antigenic peptide trimming by ER aminopeptidases--insights from structural studies.
23435305 2013 Endoplasmic reticulum aminopeptidase 2 haplotypes play a role in modulating susceptibility to HIV infection.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22837489 2012 A common single nucleotide polymorphism in endoplasmic reticulum aminopeptidase 2 induces a specificity switch that leads to altered antigen processing.
22505422 2012 Crystallization and preliminary X-ray diffraction analysis of human endoplasmic reticulum aminopeptidase 2.
22106953 2012 The crystal structure of human endoplasmic reticulum aminopeptidase 2 reveals the atomic basis for distinct roles in antigen processing.
21719416 2011 A common functional variant of endoplasmic reticulum aminopeptidase 2 (ERAP2) that reduces major histocompatibility complex class I expression is not associated with ankylosing spondylitis.
21569342 2011 Fetal ERAP2 variation is associated with preeclampsia in African Americans in a case-control study.
21314638 2011 Probing the S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
21299892 2011 Bimodal distribution of RNA expression levels in human skeletal muscle tissue.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20976248 2010 Balancing selection maintains a form of ERAP2 that undergoes nonsense-mediated decay and affects antigen presentation.
20843824 2010 Genetic diversity at endoplasmic reticulum aminopeptidases is maintained by balancing selection and is associated with natural resistance to HIV-1 infection.
20595269 2010 Serum cytokine receptors in ankylosing spondylitis: relationship to inflammatory markers and endoplasmic reticulum aminopeptidase polymorphisms.
20419298 2010 Distinct molecular mechanisms leading to deficient expression of ER-resident aminopeptidases in melanoma.
20103633 2010 NF-kappaB, and not MYCN, regulates MHC class I and endoplasmic reticulum aminopeptidases in human neuroblastoma cells.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19433412 2010 Association of an ERAP1 ERAP2 haplotype with familial ankylosing spondylitis.
18393273 2008 Altered expression of endoplasmic reticulum aminopeptidases ERAP1 and ERAP2 in transformed non-lymphoid human tissues.
18369178 2008 SNP-specific array-based allele-specific expression analysis.
17332242 2007 Inactivation of RB1 in mantle-cell lymphoma detected by nonsense-mediated mRNA decay pathway inhibition and microarray analysis.
17129607 2007 No association of type 1 diabetes with a functional polymorphism of the LRAP gene.
17088086 2006 ERAAP synergizes with MHC class I molecules to make the final cut in the antigenic peptide precursors in the endoplasmic reticulum.
16585582 2006 Expression of endoplasmic reticulum aminopeptidases in EBV-B cell lines from healthy donors and in leukemia/lymphoma, carcinoma, and melanoma cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16286653 2005 The ER aminopeptidase, ERAP1, trims precursors to lengths of MHC class I peptides by a "molecular ruler" mechanism.
16054015 2005 The oxytocinase subfamily of M1 aminopeptidases.
15908954 2005 Concerted peptide trimming by human ERAP1 and ERAP2 aminopeptidase complexes in the endoplasmic reticulum.
15691326 2005 Regulation of the human leukocyte-derived arginine aminopeptidase/endoplasmic reticulum-aminopeptidase 2 gene by interferon-gamma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12799365 2003 Human leukocyte-derived arginine aminopeptidase. The third member of the oxytocinase subfamily of aminopeptidases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12436110 2002 The ER aminopeptidase ERAP1 enhances or limits antigen presentation by trimming epitopes to 8-9 residues.
12436109 2002 An IFN-gamma-induced aminopeptidase in the ER, ERAP1, trims precursors to MHC class I-presented peptides.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11481040 2001 Genomic organization of the human adipocyte-derived leucine aminopeptidase gene and its relationship to the placental leucine aminopeptidase/oxytocinase gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.