Property Summary

Ligand Count 17
NCBI Gene PubMed Count 50
PubMed Score 53.10
PubTator Score 51.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia 2.600 4.8e-02
adult high grade glioma 1.800 4.7e-03
astrocytic glioma 1.300 4.1e-02
Astrocytoma, Pilocytic 2.600 8.2e-07
atypical teratoid / rhabdoid tumor 1.100 4.9e-02
cutaneous lupus erythematosus 1.100 6.3e-03
ependymoma 1.800 8.6e-03
esophageal adenocarcinoma 1.200 3.5e-02
gastric cancer 2.100 1.9e-02
glioblastoma 2.000 4.2e-04
head and neck cancer and chronic obstruc... 1.700 2.1e-02
interstitial lung disease 2.400 2.1e-02
juvenile dermatomyositis 1.086 2.6e-08
lung cancer -1.200 1.7e-03
lung carcinoma -1.300 8.9e-06
malignant mesothelioma 2.000 3.5e-07
medulloblastoma 1.100 1.9e-03
non primary Sjogren syndrome sicca -1.100 2.9e-02
oligodendroglioma 1.600 2.9e-02
osteosarcoma -2.096 2.3e-02
ovarian cancer -1.600 3.0e-02
primitive neuroectodermal tumor 2.300 2.2e-02
psoriasis -1.100 5.2e-03
tuberculosis 1.600 8.5e-03

Gene RIF (42)

AA Sequence

MFHSSAMVNSHRKPMFNIHRGFYCLTAILPQICICSQFSVPSSYHFTEDPGAFPVATNGERFPWQELRLP      1 - 70
SVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVL     71 - 140
SYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFYKSTYRTLGGETRILAVTDFEPTQARMAFPC    141 - 210
FDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSLSGFTSS    211 - 280
GVKVSIYASPDKRNQTHYALQASLKLLDFYEKYFDIYYPLSKLDLIAIPDFAPGAMENWGLITYRETSLL    281 - 350
FDPKTSSASDKLWVTRVIAHELAHQWFGNLVTMEWWNDIWLKEGFAKYMELIAVNATYPELQFDDYFLNV    351 - 420
CFEVITKDSLNSSRPISKPAETPTQIQEMFDEVSYNKGACILNMLKDFLGEEKFQKGIIQYLKKFSYRNA    421 - 490
KNDDLWSSLSNSCLESDFTSGGVCHSDPKMTSNMLAFLGENAEVKEMMTTWTLQKGIPLLVVKQDGCSLR    491 - 560
LQQERFLQGVFQEDPEWRALQERYLWHIPLTYSTSSSNVIHRHILKSKTDTLDLPEKTSWVKFNVDSNGY    561 - 630
YIVHYEGHGWDQLITQLNQNHTLLRPKDRVGLIHDVFQLVGAGRLTLDKALDMTYYLQHETSSPALLEGL    631 - 700
SYLESFYHMMDRRNISDISENLKRYLLQYFKPVIDRQSWSDKGSVWDRMLRSALLKLACDLNHAPCIQKA    701 - 770
AELFSQWMESSGKLNIPTDVLKIVYSVGAQTTAGWNYLLEQYELSMSSAEQNKILYALSTSKHQEKLLKL    771 - 840
IELGMEGKVIKTQNLAALLHAIARRPKGQQLAWDFVRENWTHLLKKFDLGSYDIRMIISGTTAHFSSKDK    841 - 910
LQEVKLFFESLEAQGSHLDIFQTVLETITKNIKWLEKNLPTLRTWLMVNT                        911 - 960
//

Text Mined References (55)

PMID Year Title