Property Summary

NCBI Gene PubMed Count 133
PubMed Score 198.74
PubTator Score 161.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis 2.500 1.4e-03
Multiple myeloma 1.432 5.5e-03
malignant mesothelioma 1.900 1.6e-06
esophageal adenocarcinoma 1.100 4.1e-02
osteosarcoma -1.457 2.6e-05
posterior fossa group A ependymoma 1.700 3.1e-06
glioblastoma 1.500 1.6e-04
cystic fibrosis -2.700 5.2e-04
astrocytoma 1.500 2.8e-02
atypical teratoid / rhabdoid tumor 1.400 1.3e-05
tuberculosis 1.300 2.0e-06
intraductal papillary-mucinous neoplasm ... 1.200 3.2e-03
lung cancer -1.800 4.1e-04
active Crohn's disease 1.491 2.7e-02
active ulcerative colitis 1.578 1.3e-02
diabetes mellitus -1.100 1.3e-02
pediatric high grade glioma 1.300 5.1e-05
pilocytic astrocytoma 1.600 4.7e-08
non primary Sjogren syndrome sicca -1.200 2.5e-02
breast carcinoma -1.200 6.9e-11
Breast cancer -1.800 3.8e-18
ductal carcinoma in situ -1.400 3.5e-03
invasive ductal carcinoma -1.700 1.7e-02
ovarian cancer 2.000 4.4e-04

Protein-protein Interaction (4)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
652197 screening 500 / 0 / 338637 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_SinglePoint_HTS_Activity
652221 summary 0 / 0 / 0 Broad Institute Small Molecule Probes of ERAP-1 Inhibitor Probe Project
743314 confirmatory 95 / 59 / 271 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_Dose_CherryPick_Activity_Set2
743317 confirmatory 95 / 81 / 249 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (123)

PMID Text
26399368 beta2i/MECL-1 and PA28 negatively affect C- and N-terminal cleavage and therefore epitope liberation from the proteasome, whereas ERAP1 destroys the MART-1(26-35) epitope by overtrimming activity
26393469 rs1065407 and rs10050860 of the ERAP1 gene may contribute to the genetic susceptibility of BD by modulating the expression of ERAP1.
26360328 ERAP-1 has a significant influence on the B*51:01 peptidome and its affinity which provides a mechanism for the epistatic association of ERAP-1 and B*51:01 in Behcet's disease.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking
26224046 two of the most consistently discovered disease-associated polymorphisms, namely K528R and Q730E of ERAP1, were analyzed for their effect on the ability of the enzyme to select substrates based on length and to undergo conformational changes.
26146606 ERAP1 downregulation is associated with loss of heterozygosity.
26130142 Silencing or inhibition of endoplasmic reticulum aminopeptidase 1 (ERAP1) suppresses free heavy chain expression and Th17 responses in ankylosing spondylitis.
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
26002026 Genetic variants and haplotypes of ERAP1 are associated with ankylosing spondylitis, psoriasis, and Behcet's disease in people of varying ancestries.
25994336 epistatic interaction between ERAP1 and the HLA class I alleles HLA-B*27 and HLA-B*40:01 affects susceptibility to ankylosing spondylitits
25892735 The results reveal the nature of the functional interaction between A*29:02 and ERAP1 and suggest that this enzyme may affect the susceptibility to birdshot chorioretinopathy by altering the A*29:02 peptidome.
25817437 We concluded that ERAP1 variants are associated with AS in East Asian population, indicating a common pathogenic mechanism for AS in East Asians and Caucasians.
25740711 Spondyloarthritis-associated ERAP1 polymorphisms affect the level of gene expression in antigen-presenting cells.
25665737 The 3'UTR-1008A>C and 3'UTR-1055A>G polymorphisms of ERAP1 gene are associated with essential hypertension.
25592150 Genetic or pharmacological inhibition of ERAP1 on human tumor cell lines perturbs their ability to engage several classes of inhibitory receptors.
25591727 ERAP1 as being involved in modulating innate responses of human immune cells
25545008 data suggest that ERAP1 isoforms may exhibit differential biological properties and inflammatory mediators could play critical roles in modulating ERAP1 expression, leading to altered functional activities of this enzyme.
25469497 The significant alterations in the B*27:05 peptidome and the structural features of the peptides that determine their differential expression in distinct ERAP1 contexts account for the association of the R528K polymorphism with AS
25422414 polymorphic ERAP1 alters protein function predisposing an individual to Ankylosing Spondylitis via its influence on the antigen processing pathway
25401226 Meta-analysis. ERAP1 polymorphisms were associated with AS in Caucasians, but their association with AS in Asians needs further exploration.
25354578 Data demonstrate that aberrant ERAP1 activity and HLA-B27 carriage does not alter endoplasmic reticulum stress levels in ankylosing spondylitis, suggesting that ERAP1 and HLA-B27 may influence disease susceptibility through other mechanisms.
25187574 Peptide handling by HLA-B27 subtypes influences their biological behavior, association with ankylosing spondylitis and susceptibility to ERAP1.
25142031 Studies indicate the critical role of M1 aminopeptidases ERAP1, ERAP2 and NPEPPS in immune-mediated diseases.
25019531 Our data were consistent with an association between ERAP1 and Behcet disease as well as with an epistatic interaction between ERAP1 and HLA-B in the Spanish population.
24928998 Data indicate that dimerization of endoplasmic reticulum aminopeptidases ERAP1/2 creates complexes with superior peptide-trimming efficacy.
24666027 Both HLA-B27 and ERAP1 are ankylosing spondylitis genetic susceptibility genes in the Beijing Han population.
24504800 ERAP1 directly alters peptide binding and presentation by HLA-B27, thus demonstrating a potential pathogenic mechanism in ankylosing spondylitis.
24352655 The significant and complex effects of co-occurring ERAP1 polymorphisms on multiple HLA-B27 ligands, and their potential to alter the immunological and pathogenetic features of HLA-B27 as a function of the ERAP1 context.
24223975 concerted aminoproteolytic activity of ERAP 1 and ERAP2
24046467 Results suggest that ERAP1 protein confers protection against susceptibility to ankylosing spondylitis
24028501 Endoplasmic reticulum aminopeptidase-1 alleles associated with increased risk of ankylosing spondylitis reduce HLA-B27 mediated presentation of multiple antigens.
23965983 ERAP1 levels are affected by p53 expression and this likely occurs due to a direct interaction of the p53 protein with the identified p53RE sequence in the ERAP1 gene.
23864143 an ERAP1 polymorphism was associated with ankylosing spondylitis (AS) in a Turkish population; the contributions of HLA-B27 and the rs26653 SNP to AS pathogenesis appear to be independent
23800305 The CC ERAP1 haplotype was a protective factor, while the TG haplotype was a risk factor for spondyloarthritis.
23733883 Sequencing of ERAP1 shows that single-nucleotide polymorphisms occur as distinct haplotypes in the human population and that these haplotypes encode functionally distinct ERAP1 alleles.
23696916 ERAP1 and ERAP2 might be involved in the development of immune escape mechanisms of renal cell carcinoma.
23656713 The findings suggest that the pathogenetic role of ERAP1 in ankylosing spondylitis is due to allotype-dependent alterations of the HLA-B27 peptidome that affect the immunologic and other features of HLA-B27.
23545452 [review] Generation and destruction of antigenic peptides by endoplasmic reticulum resident aminopeptidases ERAP1 and ERAP2 have been shown in the last few years to be important for correct functioning and regulation of the adaptive immune response.
23452840 ERAP1 variants associated with reduced endopeptidase activity appear to be protective against ankylosing spondylitis, raising the possibility that ERAP1 inhibition could represent a future treatment strategy.[review]
23291587 ERAP1 p.Asp575Asn and p.Arg725Gln polymorphisms recessively confer risk for Behcet's disease.
23264405 Results indicate that ERAP1 SNPs and haplotypes were associated with ankylosing spondylitis in an Iranian population.
23093722 ERAP1 was not associated with axial radiographic disease in psoriatic arthritis.
22931917 ERAP1 single-nucleotide polymorphism rs26653, which, to our knowledge, has not previously been reported in psoriasis, is nonsynonymous, has suggestive functional consequences, and herein displays strong association with disease.
22918227 This study demonstrates that natural ERAP1 polymorphism affects HLA-B27 antigen presentation and stability in vivo.
22896742 This is the first study to show an association between several polymorphisms located in ERAP1 and spondyloarthritis as a whole.
22632381 The interactions between ERAP1 genetic variations and HLA-B27 play critical roles in pMHC I pathway processing contributing to the pathogenesis of Ankylosing spondylitis
22512642 Paediatric-onset psoriasis is associated with ERAP1
22466567 The amino acid coding sequence of Exon 10 of ERAP1 is found to be important for endoplasmic reticulum retention
22355701 analysis of the binding conformation of ERAP1 to the carboxyl terminus of a peptide, and direct evidence for the molecular ruler mechanism
22253828 A functional variant in ERAP1 predisposes to multiple sclerosis.
22106953 The overall ERAP2 domain organization is highly similar to that of the recently determined structure of ERAP1 in its closed conformation. A large internal cavity adjacent to the catalytic site can accommodate large peptide substrates.
21877190 the rs27044, rs17482078, rs10050860, rs30187, and rs2287987 polymorphisms of ERAP1 are associated with the development of AS in Europeans
21865284 The ERAP1 gene is associated with genetic predisposition to ankylosing spondylitis and influences the functional severity of the disease in a Spanish population.
21833528 ERAP1 likely constitutes one of ankylosing spondylitis-associated loci of susceptibility in Chinese Han population.
21574996 over-expression of ERAP1 as a mechanism promoting ankylosing spondylitic pathogenesis.
21508329 A K(528)R mutant strongly associated with ankylosing spondylitis shows significantly altered peptide processing characteristics, which are possibly related to impaired interdomain interactions.
21478864 The crystal structure for ERAP1 is determined.
21424381 Variations in ERAP1 gene is associated with femoral neck Low bone mineral density.
21362330 HLA-I, TAP1, CNX, LMP7, Erp57, Tapasin and ERAP1 were down-regulated in 68%, 44%, 48%, 40%, 52%, 32% and 20% of esophageal squamous cell carcinoma lesions then, respectively.
21314638 S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
21281511 We present evidence for subtype specific association of the ERAP1 gene with enthesitis related Juvenile idiopathic arthritis and the IL23R gene with juvenile-onset psoriatic arthritis
21242517 Specific ERAP1 allele-substrate combinations deviate from standard enzymatic behavior, demonstrating substrate-inhibition kinetics which may affect antigen presentation in vitro.
21229357 This meta-analysis demonstrates that the ERAP1 polymorphisms may play a significant role in susceptibility to ankylosing spondylitis.
21078719 Our study demonstrated that 2 novel single nucleotide polymorphisms in ERAP1 were associated with ankylosing spondylitis in the Han Chinese population
21078719 Observational study of gene-disease association. (HuGE Navigator)
21068102 Observational study of gene-disease association. (HuGE Navigator)
21041274 This is the first confirmation in a nonwhite population that genetic polymorphisms of rs27037, rs27434, and rs10865331 are associated with ankylosing spondylitis, implicating common pathogenetic mechanisms in Korean and white patients with AS.
20953190 ERAP1 variants only influenced psoriasis susceptibility in individuals carrying the HLA-C risk allele.
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20953187 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20843824 data suggest that genetic diversity in ERAP1 and ERAP2 has been maintained by balancing selection and that variants in ERAP2 confer resistance to HIV-1 infection possibly via the presentation of a distinctive peptide repertoire to CD8(+) T cells
20843824 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595269 The ERAP1 and ERAP2 polymorphisms associated with ankylosing spondylitis (AS) do not influence the serum cytokine receptor levels in patients with AS.
20595269 Observational study of gene-disease association. (HuGE Navigator)
20592285 The intermediate accumulation properties of ERAP1 and placental leucine aminopeptidase [PLAP] are distinct and epitope dependent, suggesting that these two enzymes may impose different selective pressures on epitope generation.
20419298 heterogeneous expression in melanoma cell lines
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367925 The absence or down-regulated expression of ERAP1 is closely related to the metastasis and invasion of lymph node in ovarian carcinoma.
20347630 Polymorphisms in ERAP1 associate with susceptibility to human congenital toxoplasmosis.
20103633 Data show the downregulation of MHC class I, ERAP1, and ERAP2 in aggressive NB cells is attributable to a low transcriptional availability of NF-kappaB, possibly due to an unknown suppressor other than MYCN.
20062062 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20032103 We confirmed reported associations of ARTS1 gene polymorphisms with ankylosing spondylitis in a Hungarian cohort study.
20032103 Observational study of gene-disease association. (HuGE Navigator)
19917163 single nucleotide polymorphisms in interleukin 23Receptor and ERAP1 (endoplasmic reticulum aminopeptidase 1) genes are associated with susceptibility to ankylosing spondylitis in the Portuguese population
19917163 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19877036 Genetic polymorphisms in ERAP1 are associated with ankylosing spondylitis (AS) in Han Chinese. IL23R is not associated with AS in Chinese.
19877036 Observational study of gene-disease association. (HuGE Navigator)
19828632 ERAP1 is responsible for removing amino- terminal sequences from antigenic precursors in the endoplasmic reticulum, a key determinant of the amount of epitope displayed on the cell surface and the specificity of the immune response to invading pathogens.
19692350 A number of highly significant associations were identified in regulatory sequences which are good candidates for causing susceptibility to AS, possibly by regulating ERAP1 expression.
19692350 Observational study of gene-disease association. (HuGE Navigator)
19578876 Observational study of gene-disease association. (HuGE Navigator)
19433412 Results show that one ERAP1 SNP and a haplotype in the ERAP1 and ERAP2 locus are associated with familial ankylosing spondylitis.
19433412 Observational study of gene-disease association. (HuGE Navigator)
19414429 This is first confirmation in a non-Caucasian population that genetic polymorphisms in ARTS1 are associated with ankylosing spondylitis, implicating common pathogenetic mechanisms in Korean and Caucasian patients with ankylosing spondylitis.
19414429 Observational study of gene-disease association. (HuGE Navigator)
19404951 The data indicate that an AS disease locus may reside on a specific ERAP1 haplotype, and its effect is not multiplicative with contributions from TAP and LMP genes.
19404951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19202550 data indicate variation in ERAP1 is an important contributing factor in cervical carcinogenesis, progressive tumor growth & survival; location of ERAP1-127 SNP in peptidase M1 domain of ERAP1 suggests functional consequences of variation at this locus
19110536 Observational study of gene-disease association. (HuGE Navigator)
18987748 ERAP1 recognizes the full length of its peptide-substrate and not just the N- and C- termini. It is possible that ERAP1 trimming preferences influence the rate of generation and the composition of antigenic peptides in vivo.
18593381 These results indicate that Gln(181) is critical for the enzymatic activity and substrate specificity of ERAP-1.
18445477 This identifies RBMX as an ARTS-1-associated protein that regulates both the constitutive release of TNFR1 exosome-like vesicles and the inducible proteolytic cleavage of TNFR1 ectodomains.
18393273 Results describe the altered expression of endoplasmic reticulum aminopeptidases ERAP1 and ERAP2 in transformed non-lymphoid human tissues.
17999179 Data show that adipocyte-derived leucine aminopeptidase (A-LAP) plays important roles in the regulation of blood pressure under both the physiological and pathological conditions.
17952073 Single nucleotide polymorphism in ARTS1 gene is associated with ankylosing spondylitis
17390085 Observational study of gene-disease association. (HuGE Navigator)
17015730 generation of an HLA-A-associated epitope from tyrosinase is dependent on glycosylation in the ER, and subsequent deglycosylation by peptide-N-glycanase in the cytosol, due to an inability of ER aminopeptidase 1 to efficiently remove N-terminal residues
16585582 low and/or imbalanced expression of ERAP1 and probably ERAP2 may cause improper Ag processing and favor tumor escape from immune surveillance
16407280 nucleobindin-2-ARTS-1 complexes play an important role in mediating tumor necrosis factor receptor 1 release to the extracellular compartment.
16407280 Calcium-dependent ARTS-1-nucleobindin 2 complexes associate with TNFR1 prior to the commitment of TNFR1 to pathways that result in the constitutive release of TNFR1 exosome-like vesicles or the inducible proteolytic cleavage of TNFR1 ectodomains.
16286653 ERAP1 is specialized to process precursors transported by transporter associated with antigen processing (TAP) to peptides that can serve as MHC class I epitopes.
16054015 oxytocinase subfamily of M1 aminopeptidases play important roles in the maintenance of homeostasis including maintenance of normal pregnancy, memory retention, blood pressure regulation and antigen presentation [review]
15908954 ERAP1 was unable to remove several N-terminal amino acids that were trimmed efficiently ERAP2. ERAP1 and ERAP2 are both needed for digestion and cellular antigen presentation.
15314084 A-LAP may fit the endometrial localization as an antigen-presenting endoplasmic reticulum aminopeptidase
14662887 The ability of ARTS-1 to enhance type II interleukin-1 (IL-1) decoy receptor shedding represents a new mechanism by which IL-1-induced cellular events can be modulated.
12748171 type 1 tumor necrosis factor receptor shedding aminopeptidase regulator(ARTS-1) promotes shedding of two cytokine receptor superfamilies, type I cytokine receptor superfamily (interleukin-6Ralpha) and tumor necrosis factor receptor superfamily (TNFR1)
12748171 ARTS-1 is required for interleukin-6 receptor shedding.
12436110 enhances or limits antigen presentation by trimming epitopes to 8-9 residues
12368856 Customizes antigenic peptides presented by MHC I molecules in the ER
12189246 ARTS-1 has been identified as a novel TNFR1 binding protein that promotes TNFR1 shedding.
11857741 Association has been confirmed between the Lys528Arg polymorphism of the adipocyte-derived leucine aminopeptidase gene and essential hypertension.

AA Sequence

MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIPVHYDLLIHAN      1 - 70
LTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPLQVLEHPRQEQIALLAPEPLL     71 - 140
VGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILASTQFEPTAARMAFPCFDEPAFKASFSIKIRRE    141 - 210
PRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQAD    211 - 280
YALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMT    281 - 350
VAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS    351 - 420
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWDSMASICPTDG    421 - 490
VKGMDGFCSRSQHSSSSSHWHQEGVDVKTMMNTWTLQKGFPLITITVRGRNVHMKQEHYMKGSDGAPDTG    491 - 560
YLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTA    561 - 630
VSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFK    631 - 700
AFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLA    701 - 770
VFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG    771 - 840
RNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQ    841 - 910
TIETIEENIGWMDKNFDKIRVWLQSEKLERM                                           911 - 941
//

Text Mined References (136)

PMID Year Title
26399368 2015 The proteasome immunosubunits, PA28 and ER-aminopeptidase 1 protect melanoma cells from efficient MART-126-35 -specific T-cell recognition.
26393469 2015 Association of ERAP1 Gene Polymorphisms With Behçet's Disease in Han Chinese.
26360328 2016 The Peptidome of Behçet's Disease-Associated HLA-B*51:01 Includes Two Subpeptidomes Differentially Shaped by Endoplasmic Reticulum Aminopeptidase 1.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking.
26224046 2015 Effects of polymorphic variation on the mechanism of Endoplasmic Reticulum Aminopeptidase 1.
26146606 2015 Molecular backgrounds of ERAP1 downregulation in cervical carcinoma.
26130142 2016 Silencing or inhibition of endoplasmic reticulum aminopeptidase 1 (ERAP1) suppresses free heavy chain expression and Th17 responses in ankylosing spondylitis.
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
26002026 2015 Endoplasmic reticulum-associated amino-peptidase 1 and rheumatic disease: genetics.
25994336 2015 Major histocompatibility complex associations of ankylosing spondylitis are complex and involve further epistasis with ERAP1.
25892735 2015 Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) Polymorphism Relevant to Inflammatory Disease Shapes the Peptidome of the Birdshot Chorioretinopathy-Associated HLA-A*29:02 Antigen.
25817437 2015 ERAP1 variants are associated with ankylosing spondylitis in East Asian population: a new Chinese case-control study and meta-analysis of published series.
25740711 2015 ERAP1 Gene Expression Is Influenced by Nonsynonymous Polymorphisms Associated With Predisposition to Spondyloarthritis.
25665737 2015 Association of single nucleotide polymorphisms in the 3'UTR of ERAP1 gene with essential hypertension in the Northeastern Han Chinese.
25592150 2015 ERAP1 regulates natural killer cell function by controlling the engagement of inhibitory receptors.
25591727 2015 Autoimmune disease-associated variants of extracellular endoplasmic reticulum aminopeptidase 1 induce altered innate immune responses by human immune cells.
25545008 2015 Differences between disease-associated endoplasmic reticulum aminopeptidase 1 (ERAP1) isoforms in cellular expression, interactions with tumour necrosis factor receptor 1 (TNF-R1) and regulation by cytokines.
25469497 2015 Dominant role of the ERAP1 polymorphism R528K in shaping the HLA-B27 Peptidome through differential processing determined by multiple peptide residues.
25422414 2014 Functionally distinct ERAP1 allotype combinations distinguish individuals with Ankylosing Spondylitis.
25401226 2015 Associations between ERAP1 polymorphisms and ankylosing spondylitis susceptibility: An updated meta-analysis.
25354578 Disease-associated polymorphisms in ERAP1 do not alter endoplasmic reticulum stress in patients with ankylosing spondylitis.
25187574 2014 Peptide handling by HLA-B27 subtypes influences their biological behavior, association with ankylosing spondylitis and susceptibility to endoplasmic reticulum aminopeptidase 1 (ERAP1).
25142031 2014 Genetic associations and functional characterization of M1 aminopeptidases and immune-mediated diseases.
25019531 2014 Epistatic interaction of ERAP1 and HLA-B in Behçet disease: a replication study in the Spanish population.
24957906 2014 A genome-wide association study identifies a functional ERAP2 haplotype associated with birdshot chorioretinopathy.
24928998 2014 ERAP1-ERAP2 dimerization increases peptide-trimming efficiency.
24666027 2014 Association of HLA-B27 and ERAP1 with ankylosing spondylitis susceptibility in Beijing Han Chinese.
24504800 2014 Critical role of endoplasmic reticulum aminopeptidase 1 in determining the length and sequence of peptides bound and presented by HLA-B27.
24352655 2014 Combined effects of ankylosing spondylitis-associated ERAP1 polymorphisms outside the catalytic and peptide-binding sites on the processing of natural HLA-B27 ligands.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223975 2013 Concerted in vitro trimming of viral HLA-B27-restricted ligands by human ERAP1 and ERAP2 aminopeptidases.
24046467 2013 Protective effect of an ERAP1 haplotype in ankylosing spondylitis: investigating non-MHC genes in HLA-B27-positive individuals.
24028501 2013 Endoplasmic reticulum aminopeptidase-1 alleles associated with increased risk of ankylosing spondylitis reduce HLA-B27 mediated presentation of multiple antigens.
23965983 2013 p53 increases MHC class I expression by upregulating the endoplasmic reticulum aminopeptidase ERAP1.
23864143 2013 A polymorphism in ERAP1 is associated with susceptibility to ankylosing spondylitis in a Turkish population.
23800305 2013 Functional variants of ERAP1 gene are associated with HLA-B27 positive spondyloarthritis.
23733883 2013 Naturally occurring ERAP1 haplotypes encode functionally distinct alleles with fine substrate specificity.
23696916 2013 Comparative expression profiling for human endoplasmic reticulum-resident aminopeptidases 1 and 2 in normal kidney versus distinct renal cell carcinoma subtypes.
23656713 2013 ERAP1 in ankylosing spondylitis: genetics, biology and pathogenetic role.
23545452 2013 Antigenic peptide trimming by ER aminopeptidases--insights from structural studies.
23452840 2013 ERAP1 and ankylosing spondylitis.
23291587 2013 Genome-wide association analysis identifies new susceptibility loci for Behçet's disease and epistasis between HLA-B*51 and ERAP1.
23264405 2012 Association between endoplasmic reticulum aminopeptidase-1 (ERAP-1) and susceptibility to ankylosing spondylitis in Iran.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23093722 2013 Exploring ankylosing spondylitis-associated ERAP1, IL23R and IL12B gene polymorphisms in subphenotypes of psoriatic arthritis.
22931917 2013 Genetic association with ERAP1 in psoriasis is confined to disease onset after puberty and not dependent on HLA-C*06.
22918227 2012 Functional interaction of the ankylosing spondylitis-associated endoplasmic reticulum aminopeptidase 1 polymorphism and HLA-B27 in vivo.
22896742 2013 Investigating the genetic association between ERAP1 and spondyloarthritis.
22632381 2012 ERAP1 genetic variations associated with HLA-B27 interaction and disease severity of syndesmophytes formation in Taiwanese ankylosing spondylitis.
22512642 2012 Paediatric-onset psoriasis is associated with ERAP1 and IL23R loci, LCE3C_LCE3B deletion and HLA-C*06.
22466567 2012 Exon 10 coding sequence is important for endoplasmic reticulum retention of endoplasmic reticulum aminopeptidase 1.
22355701 2011 Structural insights into the molecular ruler mechanism of the endoplasmic reticulum aminopeptidase ERAP1.
22286212 2012 Genome-wide association study of classical Hodgkin lymphoma and Epstein-Barr virus status-defined subgroups.
22253828 2012 A functional variant in ERAP1 predisposes to multiple sclerosis.
22106953 2012 The crystal structure of human endoplasmic reticulum aminopeptidase 2 reveals the atomic basis for distinct roles in antigen processing.
21877190 2011 Associations between ERAP1 polymorphisms and ankylosing spondylitis susceptibility: a meta-analysis.
21865284 2011 ERAP1 polymorphisms and haplotypes are associated with ankylosing spondylitis susceptibility and functional severity in a Spanish population.
21833528 2012 Susceptibility to ankylosing spondylitis: evidence for the role of ERAP1, TGFb1 and TLR9 gene polymorphisms.
21743469 2011 Interaction between ERAP1 and HLA-B27 in ankylosing spondylitis implicates peptide handling in the mechanism for HLA-B27 in disease susceptibility.
21574996 2011 Expression of MHC class I dimers and ERAP1 in an ankylosing spondylitis patient cohort.
21508329 2011 Crystal structures of the endoplasmic reticulum aminopeptidase-1 (ERAP1) reveal the molecular basis for N-terminal peptide trimming.
21478864 2011 Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
21424381 2011 Identification of QTL genes for BMD variation using both linkage and gene-based association approaches.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
21314638 2011 Probing the S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
21281511 2011 Subtype specific genetic associations for juvenile idiopathic arthritis: ERAP1 with the enthesitis related arthritis subtype and IL23R with juvenile psoriatic arthritis.
21269460 2011 Initial characterization of the human central proteome.
21242517 2011 Cutting Edge: Coding single nucleotide polymorphisms of endoplasmic reticulum aminopeptidase 1 can affect antigenic peptide generation in vitro by influencing basic enzymatic properties of the enzyme.
21229357 2012 The association between seven ERAP1 polymorphisms and ankylosing spondylitis susceptibility: a meta-analysis involving 8,530 cases and 12,449 controls.
21078719 2011 ERAP1 is associated with ankylosing spondylitis in Han Chinese.
21068102 2011 Association of STAT3 and TNFRSF1A with ankylosing spondylitis in Han Chinese.
21041274 2011 Genetic studies of ankylosing spondylitis in Koreans confirm associations with ERAP1 and 2p15 reported in white patients.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953187 2010 Association analyses identify six new psoriasis susceptibility loci in the Chinese population.
20843824 2010 Genetic diversity at endoplasmic reticulum aminopeptidases is maintained by balancing selection and is associated with natural resistance to HIV-1 infection.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595269 2010 Serum cytokine receptors in ankylosing spondylitis: relationship to inflammatory markers and endoplasmic reticulum aminopeptidase polymorphisms.
20592285 2010 Placental leucine aminopeptidase efficiently generates mature antigenic peptides in vitro but in patterns distinct from endoplasmic reticulum aminopeptidase 1.
20419298 2010 Distinct molecular mechanisms leading to deficient expression of ER-resident aminopeptidases in melanoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20367925 2010 [Expression and significance of differentially expressed protein endoplasmic reticulum aminopeptidase 1 in ovarian carcinoma with lymph node metastasis].
20347630 2010 Identification of T. gondii epitopes, adjuvants, and host genetic factors that influence protection of mice and humans.
20103633 2010 NF-kappaB, and not MYCN, regulates MHC class I and endoplasmic reticulum aminopeptidases in human neuroblastoma cells.
20062062 2010 Genome-wide association study of ankylosing spondylitis identifies non-MHC susceptibility loci.
20032103 2010 Association of ARTS1 gene polymorphisms with ankylosing spondylitis in the Hungarian population: the rs27044 variant is associated with HLA-B*2705 subtype in Hungarian patients with ankylosing spondylitis.
19946888 2010 Defining the membrane proteome of NK cells.
19917163 Association of IL23R and ERAP1 genes with ankylosing spondylitis in a Portuguese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19877036 2009 Association of ERAP1, but not IL23R, with ankylosing spondylitis in a Han Chinese population.
19828632 2009 The specificity of trimming of MHC class I-presented peptides in the endoplasmic reticulum.
19692350 2009 Investigating the genetic association between ERAP1 and ankylosing spondylitis.
19581569 2009 Genome-wide association study of alcohol dependence.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19433412 2010 Association of an ERAP1 ERAP2 haplotype with familial ankylosing spondylitis.
19414429 2010 ARTS1 polymorphisms are associated with ankylosing spondylitis in Koreans.
19404951 2009 Association of a specific ERAP1/ARTS1 haplotype with disease susceptibility in ankylosing spondylitis.
19202550 2009 Single nucleotide polymorphisms in antigen processing machinery component ERAP1 significantly associate with clinical outcome in cervical carcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
18987748 2008 The internal sequence of the peptide-substrate determines its N-terminus trimming by ERAP1.
18593381 2008 Glutamine-181 is crucial in the enzymatic activity and substrate specificity of human endoplasmic-reticulum aminopeptidase-1.
18445477 2008 An association between RBMX, a heterogeneous nuclear ribonucleoprotein, and ARTS-1 regulates extracellular TNFR1 release.
18393273 2008 Altered expression of endoplasmic reticulum aminopeptidases ERAP1 and ERAP2 in transformed non-lymphoid human tissues.
17999179 2008 Biochemical and enzymatic properties of the M1 family of aminopeptidases involved in the regulation of blood pressure.
17952073 2007 Association scan of 14,500 nonsynonymous SNPs in four diseases identifies autoimmunity variants.
17390085 2007 Association of candidate gene polymorphisms with bone mineral density in community-dwelling Japanese women and men.
17088086 2006 ERAAP synergizes with MHC class I molecules to make the final cut in the antigenic peptide precursors in the endoplasmic reticulum.
17015730 2006 Processing of a class I-restricted epitope from tyrosinase requires peptide N-glycanase and the cooperative action of endoplasmic reticulum aminopeptidase 1 and cytosolic proteases.
16585582 2006 Expression of endoplasmic reticulum aminopeptidases in EBV-B cell lines from healthy donors and in leukemia/lymphoma, carcinoma, and melanoma cell lines.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16407280 2006 Extracellular TNFR1 release requires the calcium-dependent formation of a nucleobindin 2-ARTS-1 complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286653 2005 The ER aminopeptidase, ERAP1, trims precursors to lengths of MHC class I peptides by a "molecular ruler" mechanism.
16054015 2005 The oxytocinase subfamily of M1 aminopeptidases.
16034137 2005 Bacterial induction of TNF-alpha converting enzyme expression and IL-6 receptor alpha shedding regulates airway inflammatory signaling.
15908954 2005 Concerted peptide trimming by human ERAP1 and ERAP2 aminopeptidase complexes in the endoplasmic reticulum.
15691326 2005 Regulation of the human leukocyte-derived arginine aminopeptidase/endoplasmic reticulum-aminopeptidase 2 gene by interferon-gamma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314084 2004 Distribution of adipocyte-derived leucine aminopeptidase (A-LAP)/ER-aminopeptidase (ERAP)-1 in human uterine endometrium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662887 2003 Shedding of the type II IL-1 decoy receptor requires a multifunctional aminopeptidase, aminopeptidase regulator of TNF receptor type 1 shedding.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12748171 2003 An aminopeptidase, ARTS-1, is required for interleukin-6 receptor shedding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12436110 2002 The ER aminopeptidase ERAP1 enhances or limits antigen presentation by trimming epitopes to 8-9 residues.
12436109 2002 An IFN-gamma-induced aminopeptidase in the ER, ERAP1, trims precursors to MHC class I-presented peptides.
12368856 2002 ERAAP customizes peptides for MHC class I molecules in the endoplasmic reticulum.
12189246 2002 Identification of ARTS-1 as a novel TNFR1-binding protein that promotes TNFR1 ectodomain shedding.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11857741 2002 Identification of 33 polymorphisms in the adipocyte-derived leucine aminopeptidase (ALAP) gene and possible association with hypertension.
11481040 2001 Genomic organization of the human adipocyte-derived leucine aminopeptidase gene and its relationship to the placental leucine aminopeptidase/oxytocinase gene.
11056387 2000 Characterization of recombinant human adipocyte-derived leucine aminopeptidase expressed in Chinese hamster ovary cells.
10220586 1999 Molecular cloning of adipocyte-derived leucine aminopeptidase highly related to placental leucine aminopeptidase/oxytocinase.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.