Property Summary

Ligand Count 9
NCBI Gene PubMed Count 148
PubMed Score 221.01
PubTator Score 161.99

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


  Differential Expression (24)

Disease log2 FC p
psoriasis -1.500 9.7e-03
active Crohn's disease 1.491 2.7e-02
active ulcerative colitis 1.578 1.3e-02
adult high grade glioma 1.300 3.5e-04
astrocytoma 1.500 2.8e-02
Astrocytoma, Pilocytic 1.200 5.6e-04
atypical teratoid / rhabdoid tumor 1.400 1.3e-05
Breast cancer -1.800 3.8e-18
breast carcinoma -1.200 6.9e-11
cystic fibrosis -1.594 3.1e-04
diabetes mellitus -1.100 1.3e-02
ductal carcinoma in situ -1.400 3.5e-03
ependymoma 1.300 1.3e-08
esophageal adenocarcinoma 1.100 4.1e-02
glioblastoma 1.100 5.0e-07
intraductal papillary-mucinous neoplasm ... 1.200 3.2e-03
invasive ductal carcinoma -1.700 1.7e-02
lung cancer -1.800 4.1e-04
malignant mesothelioma 1.900 1.6e-06
Multiple myeloma 1.432 5.5e-03
non primary Sjogren syndrome sicca -1.200 2.5e-02
osteosarcoma -1.025 4.3e-02
ovarian cancer -1.800 2.6e-04
tuberculosis 1.300 2.0e-06

Protein-protein Interaction (4)

Gene RIF (138)

AA Sequence

TIETIEENIGWMDKNFDKIRVWLQSEKLERM                                           911 - 941

Text Mined References (151)

PMID Year Title