Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.82
PubTator Score 8.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer -1.700 1.6e-02
osteosarcoma -2.498 2.8e-03
glioblastoma 1.600 6.1e-04
juvenile dermatomyositis 2.924 8.1e-15
Atopic dermatitis 1.500 1.9e-03
primary pancreatic ductal adenocarcinoma 1.685 1.1e-03
tuberculosis 1.400 2.5e-03
intraductal papillary-mucinous neoplasm ... 2.400 1.6e-03
Hydrolethalus syndrome -2.651 2.0e-02
active Crohn's disease 1.369 8.9e-03
interstitial cystitis 2.100 7.2e-03
cystic fibrosis 1.900 8.3e-04
adult high grade glioma 1.600 8.6e-05
pilocytic astrocytoma 1.300 2.1e-04
primary Sjogren syndrome 2.000 7.9e-06
pancreatic carcinoma -1.700 1.6e-02
psoriasis 2.500 1.7e-37
subependymal giant cell astrocytoma 1.640 2.6e-03
invasive ductal carcinoma 1.900 1.4e-03
lung carcinoma -1.200 4.1e-08
breast carcinoma 1.100 1.9e-24
Breast cancer 1.300 1.7e-04
gastric carcinoma 1.300 5.0e-02
acute myeloid leukemia -1.900 6.5e-03
ulcerative colitis 1.300 7.1e-04
ovarian cancer 2.700 1.4e-04

Gene RIF (3)

PMID Text
24096480 A novel KLF8 to EPSTI1 to VCP to NF-kappaB signaling mechanism potentially critical for breast cancer invasion and metastasis.
23898208 HIV-1 Tat upregulates the expression of epithelial stromal interaction 1 (EPSTI1) in human primary T cells
20133812 These observations implicate EPSTI1 as a hitherto unappreciated regulator of tumor cell properties.

AA Sequence

MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI      1 - 70
APNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREE     71 - 140
SVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSA    141 - 210
VCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTE    211 - 280
HRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGI                                    281 - 318
//

Text Mined References (15)

PMID Year Title
24096480 2014 Identification of epithelial stromal interaction 1 as a novel effector downstream of Krüppel-like factor 8 in breast cancer invasion and metastasis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20133812 2010 Epithelial-stromal interaction 1 (EPSTI1) substitutes for peritumoral fibroblasts in the tumor microenvironment.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16769699 2005 Isolation and expression profiling of genes upregulated in the peripheral blood cells of systemic lupus erythematosus patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991720 2002 Identification of EPSTI1, a novel gene induced by epithelial-stromal interaction in human breast cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.