Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.63
PubTator Score 3.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
breast carcinoma 1.300 1.6e-02
colon cancer 1.200 2.0e-02
fibroadenoma 1.700 3.5e-02
intraductal papillary-mucinous adenoma (... 1.600 8.3e-05
intraductal papillary-mucinous carcinoma... 1.700 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.8e-04
invasive ductal carcinoma 1.200 1.8e-02
lung cancer -1.300 4.0e-03
malignant mesothelioma 1.100 6.8e-05
nasopharyngeal carcinoma -1.400 2.0e-07
ovarian cancer -1.100 1.3e-03
pancreatic cancer 1.600 1.4e-05
pancreatic ductal adenocarcinoma liver m... 1.571 2.6e-02
primary Sjogren syndrome -1.500 5.0e-03
spina bifida -1.762 4.5e-02

AA Sequence

MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGR      1 - 70
VWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLLLLVCQEPERAQPDVHFFQGL     71 - 140
RLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRDRSPAAETPPLQRRPSVRAVISTVERGAGRG    141 - 210
RPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAE    211 - 280
AARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLF    281 - 350
GPLQMIVNTSGGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEF    351 - 420
FSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCNYDFQ    421 - 490
ARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAP    491 - 560
APAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLIVNEELQARLAQGRSGPSRAVPGPRAPEPQL    561 - 630
SPGSDASEVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKV    631 - 700
SELEAVMEKQKKKVEGEVEMEVI                                                   701 - 723
//

Text Mined References (18)

PMID Year Title