Property Summary

NCBI Gene PubMed Count 67
PubMed Score 77.15
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.800 6.5e-09
esophageal adenocarcinoma 2.000 2.2e-02
psoriasis -1.100 2.5e-03
cystic fibrosis -1.812 8.6e-07
glioblastoma 1.200 2.6e-03
medulloblastoma, large-cell -1.200 8.3e-03
Duchenne muscular dystrophy 1.228 1.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.308 6.1e-03
juvenile dermatomyositis 1.295 7.6e-10
acute quadriplegic myopathy 1.702 6.1e-06
primary pancreatic ductal adenocarcinoma 1.804 1.4e-03
intraductal papillary-mucinous adenoma (... 1.300 4.7e-02
pancreatic cancer 1.600 4.1e-03
group 3 medulloblastoma 1.600 2.4e-03
pilocytic astrocytoma 1.100 4.2e-05
aldosterone-producing adenoma -1.002 1.8e-02
Breast cancer -1.100 7.0e-05
mucosa-associated lymphoid tissue lympho... 2.139 3.4e-02
ovarian cancer -3.500 1.5e-07
pituitary cancer 2.700 1.0e-08
Down syndrome 1.100 2.9e-03
dermatomyositis 1.400 2.9e-03

Protein-protein Interaction (2)

Gene RIF (34)

PMID Text
26976596 Eps8 is required for continuous membrane blebbing.
26163656 Erk activity promotes actin bundling by Eps8 to enhance cortex tension and drive the bleb-based migration of cancer cells under non-adhesive confinement.
25843487 EPS8, as MDR1 and WT1, may be a clinically valuable biomarker for assessing the outcome of ALL patients.
25376540 These results indicate that employing the native and modified epitopes identified here in Eps8-based immunotherapy for HLA-A2.1 positive cancer patients may result in efficient anticancer immune responses for diverse tumor types.
25359883 Eps8 is a crucial mediator of Src- and FAK-regulated processes.
25333707 Eps8 is overexpressed in human breast cancers, possibly by regulating ERK signaling, MMP9, p53 and EMT-like transition to affect breast cancer cell growth, migration and invasion.
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24741995 EPS8 is an F-actin capping and bundling protein. Mutant mice lacking EPS8 (Eps8-/- mice), which is present in the hair bundle, the sensory antenna of the auditory sensory cells that operate the mechano-electrical transduction
24409660 results suggest that Eps8 may serve as a prognostic factor of responsiveness to chemotherapy in AML patients
23626693 Novel binding partners and differentially regulated phosphorylation sites clarify Eps8 as a multi-functional adaptor.
23314863 Identify Fbxw5-driven fluctuation of Eps8 levels as an important mechanism that contributes to cell-shape changes during entry into-and exit from-mitosis.
23229386 We found that Eps8 mediates cell proliferation and survival of glioma cells, at least in part, by affecting phosphorylated ERK and Akt/beta-catenin activities.
23203811 Eps8 functions as a key coordinator in the interplay between FGFR signalling and trafficking.
22897151 Eps8 is frequently expressed in OSCC. The aberrant expression of Eps8 closely correlated with poor survival in patients with OSCC.
22876043 The loss of EPS8 expression in colorectal adenomas and carcinomas suggests that down regulation of this gene contributes to the development of a subset of colorectal cancers.
22683923 silencing of the protein by siRNA abrogated the migratory and invasive capacity of three different glioblastoma cell lines both in 2-dimensional and 3-dimensional in vitro assays.
22493489 Eps8 is a key regulator of the LPS-stimulated TLR4-MyD88 interaction and contributes to macrophage phagocytosis
22449706 The ITSN2 interacts with Eps8 and stimulates the degradation of Eps8 proteins.
21814501 Studied generation of filopodia with regards to the dynamic interaction established by Eps8, IRSp53 and VASP with actin filaments.
21357683 critical role for JNK2 and EPS8 in receptor tyrosine kinase signaling and trafficking to convey distinctly different effects on cell migration.
21118970 Study implicates that the integrity of SOS1/EPS8/ABI1 tri-complex is a determinant of ovarian cancer metastasis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20418908 IRSp53, through its interaction with Eps8, not only affects cell migration but also dictates cellular growth in cancer cells.
20351091 Overexpression of EPS8 induced expression of the chemokine ligands CXCL5 and CXCL12 in a FOXM1-dependent manner, which was blocked by LY294002 or a dominant-negative form of AKT
20184880 Eps8 is recruited to lysosomes and subjected to chaperone-mediated autophagy in cancer cells
19528316 the crystal structures of human LanCL1, both free of and complexed with glutathione, revealing glutathione binding to a zinc ion at the putative active site formed by conserved GxxG motifs
19448673 Results show that alphavbeta6- and alpha5beta1-integrin-dependent activation of Rac1 was mediated through Eps8.
19116338 A role of Eps8 in amplifying growth factor receptor signaling in human pituitary tumors to promote proliferation and cell survival.
19008210 overexpression of EPS8 in HN4 cells was sufficient to induce growth of non-tumorigenic cells in orthotopic transplantation assays. EPS8 expression in samples of squamous cell carcinoma showed variable expression levels and paralleled expression of MMP-9
18566210 These findings implicate the involvement of Eps8 in chemoresistance and show its importance in prognosis of cervical cancer patients.
18187620 Knockdown of epidermal growth factor receptor pathway substrate 8 (EPS8) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17537571 Eps8 is essential for actin dynamics and cell interactions, independent of Eps8-like gene products.
17115031 These results support a model whereby the synergic bundling activity of the IRSp53-Eps8 complex, regulated by Cdc42, contributes to the generation of actin bundles, thus promoting filopodial protrusions.
15273867 Involved in the growth factor-controlled regulation of cell proliferation and differentiation in the seminiferous epithelium.

AA Sequence

MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHL      1 - 70
TTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVM     71 - 140
HSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIP    141 - 210
PPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDI    211 - 280
EFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQ    281 - 350
NPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEW    351 - 420
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADG    421 - 490
YAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEI    491 - 560
LDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTP    561 - 630
APVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTI    631 - 700
GRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEG    701 - 770
ARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH                      771 - 822
//

Text Mined References (73)

PMID Year Title
26976596 2016 A RhoA and Rnd3 cycle regulates actin reassembly during membrane blebbing.
26163656 2015 Erk regulation of actin capping and bundling by Eps8 promotes cortex tension and leader bleb-based migration.
25843487 2015 Overexpression of EPS8 is associated with poor prognosis in patients with acute lymphoblastic leukemia.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25376540 2015 Generation of cytotoxic T lymphocytes specific for native or modified peptides derived from the epidermal growth factor receptor pathway substrate 8 antigen.
25359883 2014 Eps8 controls Src- and FAK-dependent phenotypes in squamous carcinoma cells.
25333707 2015 Eps8 regulates cellular proliferation and migration of breast cancer.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24741995 2014 EPS8, encoding an actin-binding protein of cochlear hair cell stereocilia, is a new causal gene for autosomal recessive profound deafness.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24409660 2013 Real-time quantitative polymerase chain reaction assay for detecting the eps8 gene in acute myeloid leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23626693 2013 Novel binding partners and differentially regulated phosphorylation sites clarify Eps8 as a multi-functional adaptor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23314863 2013 SCFFbxw5 mediates transient degradation of actin remodeller Eps8 to allow proper mitotic progression.
23229386 2013 Eps8 promotes cellular growth of human malignant gliomas.
23203811 2013 Regulation of fibroblast growth factor receptor signalling and trafficking by Src and Eps8.
22897151 2012 Expression of Eps8 correlates with poor survival in oral squamous cell carcinoma.
22876043 2012 Differential roles of EPS8 in carcinogenesis: loss of protein expression in a subset of colorectal carcinoma and adenoma.
22683923 2012 Silencing of Eps8 blocks migration and invasion in human glioblastoma cell lines.
22493489 2012 Eps8 protein facilitates phagocytosis by increasing TLR4-MyD88 protein interaction in lipopolysaccharide-stimulated macrophages.
22449706 2012 Human intersectin 2 (ITSN2) binds to Eps8 protein and enhances its degradation.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21814501 2011 The Eps8/IRSp53/VASP network differentially controls actin capping and bundling in filopodia formation.
21357683 2011 c-Jun N-terminal kinase 2 (JNK2) enhances cell migration through epidermal growth factor substrate 8 (EPS8).
21118970 2010 Integrity of SOS1/EPS8/ABI1 tri-complex determines ovarian cancer metastasis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20418908 2010 The interplay between Eps8 and IRSp53 contributes to Src-mediated transformation.
20351091 2010 EPS8 upregulates FOXM1 expression, enhancing cell growth and motility.
20184880 2010 Eps8 is recruited to lysosomes and subjected to chaperone-mediated autophagy in cancer cells.
19528316 2009 Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione.
19448673 2009 Upregulation of Eps8 in oral squamous cell carcinoma promotes cell migration and invasion through integrin-dependent Rac1 activation.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19116338 2009 Epidermal growth factor receptor pathway substrate 8 is overexpressed in human pituitary tumors: role in proliferation and survival.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19008210 2009 Role for EPS8 in squamous carcinogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566210 2008 Eps8 decreases chemosensitivity and affects survival of cervical cancer patients.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17537571 2007 Eps8 is increased in pancreatic cancer and required for dynamic actin-based cell protrusions and intercellular cytoskeletal organization.
17115031 2006 Regulation of cell shape by Cdc42 is mediated by the synergic actin-bundling activity of the Eps8-IRSp53 complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16688213 2006 Cell fate-specific regulation of EGF receptor trafficking during Caenorhabditis elegans vulval development.
16618726 2006 Combined cDNA array comparative genomic hybridization and serial analysis of gene expression analysis of breast tumor progression.
16541075 2006 The finished DNA sequence of human chromosome 12.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15558031 2004 Eps8 controls actin-based motility by capping the barbed ends of actin filaments.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15289329 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness.
15273867 2004 Epidermal growth factor receptor pathway substrate 8 (Eps8) expression in maturing testis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127568 2002 Eps8 in the midst of GTPases.
11524436 2001 An effector region in Eps8 is responsible for the activation of the Rac-specific GEF activity of Sos-1 and for the proper localization of the Rac-based actin-polymerizing machine.
11487543 2001 Intestinal epithelial cells secrete exosome-like vesicles.
11244499 2001 Overexpression of p97Eps8 leads to cellular transformation: implication of pleckstrin homology domain in p97Eps8-mediated ERK activation.
11185075 2000 Detailed mapping, mutation analysis, and intragenic polymorphism identification in candidate Noonan syndrome genes MYL2, DCN, EPS8, and RPL6.
11099046 2000 The Eps8 protein coordinates EGF receptor signalling through Rac and trafficking through Rab5.
10581192 1999 Identification of EPS8 as a Dvl1-associated molecule.
10499589 1999 EPS8 and E3B1 transduce signals from Ras to Rac.
10395945 1999 Enhancement of tyrosyl phosphorylation and protein expression of eps8 by v-Src.
9010225 1997 Isolation and characterization of e3B1, an eps8 binding protein that regulates cell growth.
8700527 1996 RN-tre specifically binds to the SH3 domain of eps8 with high affinity and confers growth advantage to NIH3T3 upon carboxy-terminal truncation.
8404850 1993 Eps8, a substrate for the epidermal growth factor receptor kinase, enhances EGF-dependent mitogenic signals.
8084614 1994 Evolutionary conservation of the EPS8 gene and its mapping to human chromosome 12q23-q24.
7791787 1995 Constitutive phosphorylation of eps8 in tumor cell lines: relevance to malignant transformation.
7566980 1995 Expression of the receptor tyrosine kinase substrate genes eps8 and eps15 during mouse development.
7537362 1995 Molecular interactions of the Src homology 2 domain protein Shb with phosphotyrosine residues, tyrosine kinase receptors and Src homology 3 domain proteins.
7532293 1995 Direct binding of eps8 to the juxtamembrane domain of EGFR is phosphotyrosine- and SH2-independent.
1049958 1976 Student or worker? International Meeting of Student Nurses (European Group).