Property Summary

NCBI Gene PubMed Count 30
PubMed Score 9.12
PubTator Score 12.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 8.6e-09
malignant mesothelioma 3163 2.2e-07
Pick disease 1893 9.2e-06
osteosarcoma 7933 8.0e-05
pediatric high grade glioma 2712 1.3e-03
glioblastoma 5572 2.5e-03
lung cancer 4473 1.1e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0
Disease Target Count Z-score Confidence
Angelman syndrome 38 3.391 1.7
Tetralogy of Fallot 38 3.293 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.800 2.2e-07
osteosarcoma -1.977 8.0e-05
glioblastoma 1.300 2.5e-03
lung cancer 1.600 1.1e-02
pediatric high grade glioma 1.100 1.3e-03
Pick disease 1.500 9.2e-06
ovarian cancer 1.200 8.6e-09

AA Sequence

MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDK      1 - 70
QGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAHWAVRVEEKAKFDGIFESLLP     71 - 140
INGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSALPPSLIP    141 - 210
PSKRKKTVFPGAVPVLPASPPPKDSLRSTPSHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFD    211 - 280
EIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDP    281 - 350
PQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE    351 - 420
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESD    421 - 490
LKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRS    491 - 560
LEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDPFKNKALLFSNNTQELHPDPFQTEDPFKSDP    561 - 630
FKGADPFKGDPFQNDPFAEQQTTSTDPFGGDPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPS    631 - 700
KLDPFESSDPFSSSSVSSKGSDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPF    701 - 770
KSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP    771 - 840
FVPSSAAKPSKASASGFADFTSVS                                                  841 - 864
//

Text Mined References (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23218918 2013 White matter integrity as an intermediate phenotype: exploratory genome-wide association analysis in individuals at high risk of bipolar disorder.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21700002 A de novo 1.1Mb microdeletion of chromosome 19p13.11 provides indirect evidence for EPS15L1 to be a strong candidate for split hand split foot malformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20448150 2010 FCHo proteins are nucleators of clathrin-mediated endocytosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19262564 2009 SRBC/cavin-3 is a caveolin adapter protein that regulates caveolae function.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16159959 2005 Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.
15962011 2005 Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218189 2002 Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.
11777906 2002 Differential nucleocytoplasmic trafficking between the related endocytic proteins Eps15 and Eps15R.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.
10906484 2000 Differential patterns of expression of Eps15 and Eps15R during mouse embryogenesis.
10613896 1999 The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.
10567358 1999 The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.
9723620 1998 Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.
9446614 1998 Eps15R is a tyrosine kinase substrate with characteristics of a docking protein possibly involved in coated pits-mediated internalization.
9407958 1997 eps15 and eps15R are essential components of the endocytic pathway.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.