Property Summary

NCBI Gene PubMed Count 82
PubMed Score 171.65
PubTator Score 110.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.211 1.1e-02
malignant mesothelioma -1.200 4.2e-06
astrocytoma -1.600 4.5e-03
ependymoma -1.800 5.2e-03
oligodendroglioma -1.800 2.1e-02
glioblastoma -2.400 2.6e-06
osteosarcoma -1.412 3.7e-04
medulloblastoma -2.500 1.6e-09
atypical teratoid / rhabdoid tumor -2.800 2.7e-09
medulloblastoma, large-cell -3.200 1.1e-06
primitive neuroectodermal tumor -1.700 9.7e-04
non-small cell lung cancer -1.119 6.0e-17
lung cancer -1.300 6.9e-05
adult high grade glioma -2.200 4.1e-05
pilocytic astrocytoma -1.800 1.0e-06
Pick disease -1.100 9.3e-03
invasive ductal carcinoma -1.100 1.5e-03
ovarian cancer -2.100 8.4e-09
pituitary cancer 1.200 5.5e-06
dermatomyositis 1.300 2.0e-04

 GWAS Trait (1)

Gene RIF (20)

PMID Text
26289382 over-expression of EPS15 is a potential favorable prognostic marker in breast cancer.
25496667 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of EPS15 by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
25260758 Ubiquitin is sufficient for Eps15 recruitment to endosomes.
24269888 Results indicate that phosphorylation of epidermal growth factor receptor pathway substrate 15 (Eps15) at Ser-796 is catalyzed by p38 directly.
24173214 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22581003 MLL-EPS15 translocation and individual genomic copy number alterations in monozygotic infant twins are associated with acute lymphoblastic leukemia.
21832070 distinct forms of Eps15 direct EGFR to either the late endosome/lysosome for degradation (Eps15) or to the recycling endosome for transit back to the cell surface (Eps15S)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20106972 analysis of the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners
19875440 parkin Ubld uses differential surfaces to recruit UIM regions from the S5a proteasomal subunit compared with Eps15 involved in cell signaling.
19109251 Distinct recruitment of Eps15 via Its coiled-coil domain is required for efficient down-regulation of the met receptor tyrosine kinase.
18395097 EPS15 and EPS15R mediated internalization of activated EGF receptor to result in receptor recycling as to reinforce the proliferative response to EGF.
18362181 These results indicate that Eps15b is an endosomally localized isoform of Eps15 that is present in the Hrs complex via direct Hrs interaction and important for the sorting function of this complex.
17626015 SGIP1alpha plays an essential role in clathrin-mediated endocytosis by interacting with phospholipids and Eps15.
16159959 Data show that the first ubiquitin-interacting motif of Eps15 (UIM1) interacts directly with the UBL domain of ubiquilin, whereas it does not bind to ubiquitinated proteins.
16036216 Our results suggest that spartin might be involved in endocytosis, vesicle trafficking, or mitogenic activity, and that impairment in one of these processes may underlie the long axonopathy in patients with Troyer syndrome.
15767409 However, GFP-EH21 (a mutant Eps15) expression caused a 50% reduction in released enveloped virions, decreased formation of satellite plaques, and delayed virus spread, indicating an important role for receptor-mediated endocytosis.
14671106 JC virus binding to human glial cells induces an intracellular signal that is critical for entry and infection by a ligand-inducible clathrin and eps15-dependent mechanism.
12807910 Eps15 regulates clathrin coat assembly in vivo, and interactions between Eps15 homology domains and NPF motifs are involved in clathrin-coated vesicle formation during synaptic vesicle recycling

AA Sequence

MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNK      1 - 70
QEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKYDAIFDSLS     71 - 140
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALV    141 - 210
PPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKD    211 - 280
QFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKN    281 - 350
NVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA    351 - 420
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEIS    421 - 490
SMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPA    491 - 560
RSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDP    561 - 630
FKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTV    631 - 700
VAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPA    701 - 770
LPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP    771 - 840
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA                  841 - 896
//

Text Mined References (101)

PMID Year Title
26289382 2015 Over-expression of EPS15 is a favorable prognostic factor in breast cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25260758 2014 UIM domain-dependent recruitment of the endocytic adaptor protein Eps15 to ubiquitin-enriched endosomes.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269888 2014 p38-Mediated phosphorylation of Eps15 endocytic adaptor protein.
23211419 2013 Identification and selected reaction monitoring (SRM) quantification of endocytosis factors associated with Numb.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22581003 2012 Molecular characterization of identical, novel MLL-EPS15 translocation and individual genomic copy number alterations in monozygotic infant twins with acute lymphoblastic leukemia.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21832070 2011 Recycling of the epidermal growth factor receptor is mediated by a novel form of the clathrin adaptor protein Eps15.
21762413 2011 Characterization of the EFC/F-BAR domain protein, FCHO2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21047970 2011 The Tyro3 receptor kinase Axl enhances macropinocytosis of Zaire ebolavirus.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20448150 2010 FCHo proteins are nucleators of clathrin-mediated endocytosis.
20202662 2010 Ebola virus uses clathrin-mediated endocytosis as an entry pathway.
20106972 2010 Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19875440 2010 Differential interaction of the E3 ligase parkin with the proteasomal subunit S5a and the endocytic protein Eps15.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19458185 2009 Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19109251 2009 Distinct recruitment of Eps15 via Its coiled-coil domain is required for efficient down-regulation of the met receptor tyrosine kinase.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18395097 2008 EPS15R, TASP1, and PRPF3 are novel disease candidate genes targeted by HNF4alpha splice variants in hepatocellular carcinomas.
18362181 2008 An endosomally localized isoform of Eps15 interacts with Hrs to mediate degradation of epidermal growth factor receptor.
18200045 2008 Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
18199683 2008 The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17626015 2007 SGIP1alpha is an endocytic protein that directly interacts with phospholipids and Eps15.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17082820 2006 The UBL domain of PLIC-1 regulates aggresome formation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16429130 2006 Regulation of ubiquitin-binding proteins by monoubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16325581 2005 TTP specifically regulates the internalization of the transferrin receptor.
16314522 2005 Endosomal transport of ErbB-2: mechanism for nuclear entry of the cell surface receptor.
16159959 2005 Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.
16036216 2005 The Troyer syndrome (SPG20) protein spartin interacts with Eps15.
15962011 2005 Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15767409 2005 Role of receptor-mediated endocytosis in the formation of vaccinia virus extracellular enveloped particles.
15465819 2004 Ubiquitin ligase activity of c-Cbl guides the epidermal growth factor receptor into clathrin-coated pits by two distinct modes of Eps15 recruitment.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14755250 2004 An RNF11: Smurf2 complex mediates ubiquitination of the AMSH protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671106 2004 A JC virus-induced signal is required for infection of glial cells by a clathrin- and eps15-dependent pathway.
12807910 2003 Eps15 homology domain-NPF motif interactions regulate clathrin coat assembly during synaptic vesicle recycling.
12551915 2003 STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218189 2002 Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.
12072436 2002 A ubiquitin-interacting motif (UIM) is essential for Eps15 and Eps15R ubiquitination.
11919637 2002 A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.
11872741 2002 Interactions of phocein with nucleoside-diphosphate kinase, Eps15, and Dynamin I.
11723124 2002 Multiple signals regulate trafficking of the mannose 6-phosphate-uncovering enzyme.
11483962 2001 The Eps15 C. elegans homologue EHS-1 is implicated in synaptic vesicle recycling.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.
11062555 2000 Molecular mechanism of NPF recognition by EH domains.
10953014 2000 Tyrosine phosphorylation of Eps15 is required for ligand-regulated, but not constitutive, endocytosis.
10922467 2000 Intersectin 2, a new multimodular protein involved in clathrin-mediated endocytosis.
10809762 2000 Hrs-2 regulates receptor-mediated endocytosis via interactions with Eps15.
10791968 2000 Epsin 1 undergoes nucleocytosolic shuttling and its eps15 interactor NH(2)-terminal homology (ENTH) domain, structurally similar to Armadillo and HEAT repeats, interacts with the transcription factor promyelocytic leukemia Zn(2)+ finger protein (PLZF).
10757979 2000 Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites.
10613896 1999 The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.
10567358 1999 The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.
10514494 1999 Direct interaction of the trans-Golgi network membrane protein, TGN38, with the F-actin binding protein, neurabin.
10393179 1999 Small G protein Ral and its downstream molecules regulate endocytosis of EGF and insulin receptors.
10383425 1999 Molecular cloning and characterization of MT-ACT48, a novel mitochondrial acyl-CoA thioesterase.
10064583 1999 The EH and SH3 domain Ese proteins regulate endocytosis by linking to dynamin and Eps15.
9762922 1998 Cloning, expression, and localization of a novel gamma-adaptin-like molecule.
9723620 1998 Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.
9721102 1998 Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain.
9490719 1998 AP-2/Eps15 interaction is required for receptor-mediated endocytosis.
9428629 1997 Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.
9407139 1997 Parallel dimers and anti-parallel tetramers formed by epidermal growth factor receptor pathway substrate clone 15.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
9182572 1997 Eps15 is constitutively oligomerized due to homophilic interaction of its coiled-coil region.
9110174 1997 Large-scale concatenation cDNA sequencing.
9049247 1997 Association and colocalization of Eps15 with adaptor protein-2 and clathrin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662907 1996 Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins.
8662627 1996 The ear of alpha-adaptin interacts with the COOH-terminal domain of the Eps 15 protein.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8183552 1994 The human eps15 gene, encoding a tyrosine kinase substrate, is conserved in evolution and maps to 1p31-p32.
8134107 1994 A novel gene, AF-1p, fused to HRX in t(1;11)(p32;q23), is not related to AF-4, AF-9 nor ENL.
7797522 1995 The SH3 domain of Crk binds specifically to a conserved proline-rich motif in Eps15 and Eps15R.