Property Summary

Ligand Count 1
NCBI Gene PubMed Count 41
PubMed Score 1267.39
PubTator Score 44.78

Knowledge Summary


No data available


  Differential Expression (22)

Disease log2 FC p
astrocytoma 1.100 7.4e-03
atypical teratoid / rhabdoid tumor 1.800 1.7e-05
Breast cancer 2.200 3.7e-02
ependymoma 1.200 8.0e-04
Gaucher disease type 1 -1.500 2.3e-02
glioblastoma 2.000 4.0e-05
group 4 medulloblastoma 1.700 3.5e-04
intraductal papillary-mucinous adenoma (... 1.300 8.7e-03
intraductal papillary-mucinous carcinoma... 1.100 3.1e-03
invasive ductal carcinoma 1.200 1.1e-02
lung adenocarcinoma 1.199 5.4e-07
lung cancer 1.900 1.1e-03
medulloblastoma, large-cell 3.000 3.3e-05
Multiple myeloma 1.316 7.1e-04
non-small cell lung cancer 1.326 3.5e-15
oligodendroglioma 1.100 3.5e-02
osteosarcoma 2.313 2.5e-04
ovarian cancer 2.600 3.1e-07
pancreatic cancer -1.200 3.4e-03
pediatric high grade glioma 1.400 5.5e-04
primitive neuroectodermal tumor 1.600 4.7e-07
psoriasis 1.500 2.2e-08

Gene RIF (11)

AA Sequence

APSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY                               1471 - 1512

Text Mined References (59)

PMID Year Title