Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1189.81
PubTator Score 44.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.316 7.1e-04
oligodendroglioma 1.100 3.5e-02
psoriasis 1.500 2.2e-08
osteosarcoma 2.313 2.5e-04
ependymoma 1.200 8.0e-04
medulloblastoma 1.700 7.1e-04
astrocytoma 1.100 7.4e-03
atypical teratoid / rhabdoid tumor 1.800 1.7e-05
glioblastoma 2.000 4.0e-05
medulloblastoma, large-cell 3.000 3.3e-05
primitive neuroectodermal tumor 1.600 4.7e-07
non-small cell lung cancer 1.326 3.5e-15
intraductal papillary-mucinous adenoma (... 1.300 8.7e-03
intraductal papillary-mucinous carcinoma... 1.100 3.1e-03
lung cancer 2.100 3.7e-04
Breast cancer 2.500 3.1e-02
pediatric high grade glioma 1.400 5.5e-04
lung adenocarcinoma 1.199 5.4e-07
invasive ductal carcinoma 1.200 1.1e-02
ovarian cancer 2.600 3.1e-07
Gaucher disease type 1 -1.500 2.3e-02
pancreatic cancer -1.200 3.4e-03

Gene RIF (11)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25631074 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
25010285 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
23125841 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
22386318 Dynamic model simulations predicted an inhibitory GAIT-element-interacting factor to account for this relationship and led to the identification of a truncated form of EPRS, a GAIT constituent that mediates binding to target transcripts.
22190034 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
21220307 Study reveals a unique role of Cdk5/p35 in activation of the major noncanonical function of EPRS, namely translational control of macrophage inflammatory gene expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19647514 EPRS phosphorylation events regulate GAIT-mediated gene silencing.
18374644 Essentiality of this enzyme's domains in its noncanonical function of regulating inflammatory gene expression.
15479637 Results show that glutamyl-prolyl-tRNA synthetase has a regulated, noncanonical activity that blocks synthesis of a specific protein.

AA Sequence

MATLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGS      1 - 70
NLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQ     71 - 140
KKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKKQDVGKFVELPGAEMGKVTVRFPPEASGYL    141 - 210
HIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYA    211 - 280
EKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGC    281 - 350
MRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI    351 - 420
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWD    421 - 490
KIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVGLKPVWYSPKVFIEGADAETF    491 - 560
SEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWLAETTHALPIPVICVTYEHLI    561 - 630
TKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLI    631 - 700
YIPDGHTKEMPTSGSKEKTKVEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAK    701 - 770
KAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVRKL    771 - 840
KAEKSPKAKINEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPEAKVLFDKVAS    841 - 910
QGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQK    911 - 980
QNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILR    981 - 1050
PWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRP   1051 - 1120
TSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQIL   1121 - 1190
DLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPK   1191 - 1260
IPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDY   1261 - 1330
RRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETK   1331 - 1400
LQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPG   1401 - 1470
APSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY                               1471 - 1512
//

Text Mined References (51)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
22386318 2012 Coding region polyadenylation generates a truncated tRNA synthetase that counters translation repression.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21220307 2011 Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19647514 2009 Two-site phosphorylation of EPRS coordinates multimodal regulation of noncanonical translational control activity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18374644 2008 WHEP domains direct noncanonical function of glutamyl-Prolyl tRNA synthetase in translational control of gene expression.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16055448 2005 The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.
15994936 2005 A novel human tRNA-dihydrouridine synthase involved in pulmonary carcinogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479637 2004 Noncanonical function of glutamyl-prolyl-tRNA synthetase: gene-specific silencing of translation.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714285 2001 The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.
11123902 2000 Structural analysis of multifunctional peptide motifs in human bifunctional tRNA synthetase: identification of RNA-binding residues and functional implications for tandem repeats.
10913161 2000 Heat shock protein 90 mediates protein-protein interactions between human aminoacyl-tRNA synthetases.
9878398 1999 Macromolecular assemblage of aminoacyl-tRNA synthetases: identification of protein-protein interactions and characterization of a core protein.
9556618 1998 A multifunctional repeated motif is present in human bifunctional tRNA synthetase.
9278442 1997 Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8449960 1993 Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.
8188258 1994 The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.
8078941 1994 Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.
8052601 1994 Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.
3290852 1988 The core region of human glutaminyl-tRNA synthetase homologies with the Escherichia coli and yeast enzymes.
2227938 1990 The human QARS locus: assignment of the human gene for glutaminyl-tRNA synthetase to chromosome 1q32-42.
1988429 1991 The primary structure of human glutaminyl-tRNA synthetase. A highly conserved core, amino acid repeat regions, and homologies with translation elongation factors.
1756734 1991 A component of the multisynthetase complex is a multifunctional aminoacyl-tRNA synthetase.
1651330 1991 Structural analysis of the high molecular mass aminoacyl-tRNA synthetase complex. Effects of neutral salts and detergents.
1556743 1992 Exons encoding the highly conserved part of human glutaminyl-tRNA synthetase.