Property Summary

NCBI Gene PubMed Count 329
PubMed Score 8755.76
PubTator Score 14631.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ovarian cancer 8492 3.34322166776009E-7
atypical teratoid / rhabdoid tumor 4369 1.11913162239979E-6
glioblastoma 5572 1.92639078667592E-4
medulloblastoma, large-cell 6234 2.51053038681911E-4
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P01588 Q2M2L6 Q549U2 Q9UDZ0 Q9UEZ5 Q9UHA0
Symbols EP
MVCD2

Gene

EPO

PANTHER Protein Class (2)

PDB

1BUY   1CN4   1EER  

  Ortholog (8)

Gene RIF (300)

PMID Text
27081163 Suggest that hypoxia prevents EPO suppression, and exaggerates the plasma volume reduction induced by bed rest.
26995951 The review describes the induction of erythropoietin gene expression in liver, reproouctive and hemopoietic systems during hypoxia or a state of proliferation.
26838000 Conclusion: Anemia in cancers was not because of inadequate Epo or Fe levels, but because of improper Epo response.
26721912 Higher levels of endogenous erythropoietin are associated with incident heart failure in older adults.
26469975 Erythropoietin protects mouse renal tubular basement membrane by promoting bone marrow cells to generate and secrete miR-144, which, in turn, inhibits activation of the tPA/MMP9-mediated proteolytic network.
26447159 Data suggest maternal circulating 25-hydroxyvitamin D during mid-pregnancy and at delivery is inversely related to serum EPO; an indirect relation observed between circulating vitamin D and circulating hemoglobin is at least partly mediated by EPO.
26412593 Our findings have important potential clinical implications, indicating that EPO supplementation in rhabdomyosarcoma patients may have the unwanted side effect of tumor progression.
26261574 suggest that rhEPO regulates apoptosis-related genes and affects apoptosis in the hippocampus of aging rats by upregulating SIRT.
26097591 In multivariate survival analysis, age, Epo and EpoR were independent prognostic factors related to overall survival in hepatocellular carcinoma.
26049959 Inadequate erythropoietin response may partly explain anemia in anorexia nervosa.
More...

AA Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPD      1 - 70
TKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALG     71 - 140
AQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR                     141 - 193
//

Text Mined References (331)

PMID Year Title
27081163 2016 PlanHab: Hypoxia counteracts the erythropoietin suppression, but seems to exaggerate the plasma volume reduction induced by 3 weeks of bed rest.
26995951 2015 [REGULATION OF EXTRARENAL ERYTHROPOIETIN PRODUCTION].
26838000 A study on biochemical facet of anemia in cancers: A strong link between erythropoietin and tumor necrosis factor alpha in anemic cancer patients.
26721912 2016 Association of Serum Erythropoietin With Cardiovascular Events, Kidney Function Decline, and Mortality: The Health Aging and Body Composition Study.
26469975 2016 Erythropoietin protects the tubular basement membrane by promoting the bone marrow to release extracellular vesicles containing tPA-targeting miR-144.
26447159 2015 Vitamin D status is inversely associated with anemia and serum erythropoietin during pregnancy.
26412593 2015 Human rhabdomyosarcoma cells express functional erythropoietin receptor: Potential therapeutic implications.
26261574 2015 rhEPO affects apoptosis in hippocampus of aging rats by upregulating SIRT1.
26097591 2015 Erythropoietin and erythropoietin receptor in hepatocellular carcinoma: correlation with vasculogenic mimicry and poor prognosis.
26049959 2015 [Blunted erythropoietic response in the anemia of anorexia nervosa].
More...