Property Summary

NCBI Gene PubMed Count 329
PubMed Score 8755.76
PubTator Score 14631.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
ovarian cancer 8491 3.3e-07
atypical teratoid / rhabdoid tumor 4369 1.1e-06
glioblastoma 5572 1.9e-04
medulloblastoma, large-cell 6234 2.5e-04
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-06
glioblastoma -1.200 1.9e-04
medulloblastoma, large-cell -1.200 2.5e-04
ovarian cancer -1.400 3.3e-07

Protein-protein Interaction (6)

Gene RIF (300)

PMID Text
27081163 Suggest that hypoxia prevents EPO suppression, and exaggerates the plasma volume reduction induced by bed rest.
26995951 The review describes the induction of erythropoietin gene expression in liver, reproouctive and hemopoietic systems during hypoxia or a state of proliferation.
26838000 Conclusion: Anemia in cancers was not because of inadequate Epo or Fe levels, but because of improper Epo response.
26721912 Higher levels of endogenous erythropoietin are associated with incident heart failure in older adults.
26469975 Erythropoietin protects mouse renal tubular basement membrane by promoting bone marrow cells to generate and secrete miR-144, which, in turn, inhibits activation of the tPA/MMP9-mediated proteolytic network.
26447159 Data suggest maternal circulating 25-hydroxyvitamin D during mid-pregnancy and at delivery is inversely related to serum EPO; an indirect relation observed between circulating vitamin D and circulating hemoglobin is at least partly mediated by EPO.
26412593 Our findings have important potential clinical implications, indicating that EPO supplementation in rhabdomyosarcoma patients may have the unwanted side effect of tumor progression.
26261574 suggest that rhEPO regulates apoptosis-related genes and affects apoptosis in the hippocampus of aging rats by upregulating SIRT.
26097591 In multivariate survival analysis, age, Epo and EpoR were independent prognostic factors related to overall survival in hepatocellular carcinoma.
26049959 Inadequate erythropoietin response may partly explain anemia in anorexia nervosa.
26012423 these findings suggest that TGF-beta suppression and EPO stimulation promote erythropoiesis of CD34(+)CD31(+) progenitor cells derived from hPSCs.
25966953 Erythropoietin dampens injury-induced microglial motility.
25887776 basic mechanisms for hypoxia-inducible factor induction of EPO expression, and within erythroid progenitors EPOR engagement of canonical Janus kinase 2/signal transducer and activator of transcription 5 (JAK2/STAT5)
25793991 In very preterm infants, whether elevated perinatal erythropoietin (EPO) concentrations are associated with increased risks of indicators of brain damage, was determined.
25786542 the Epo gene changes dramatically during development--{REVIEW}
25724399 EPO is produced in most of conventional uterine leiomyomas and evidence supports a model in which EPO accelerates tumor growth, possibly by inducing vessel maturity.
25675872 Our data suggest that rs507392 and rs551238 in the erythropoietin gene probably act to lessen the risk for diabetic retinopathy (DR) in a Chinese cohort with type 2 diabetes mellitus (T2DM).
25656761 The EPO genotype in Chinese patients with type 2 diabetes is associated with anemia and may help to identify those at risk.
25630969 High erythropoietin stimulates osteoclast precursors and induces bone loss.
25628168 The addition of salt (even low concentrations of the strong chaotrope salt guanidinium hydrochloride) also exponentially decreased the initial rate of soluble erythropoietin non-native aggregation at 37 degrees C storage
25477265 Elevated erythropoietin and cytokines levels are related to impaired reticulocyte maturation in beta-thalassemic patients.
25405915 Higher Epo levels were seen in patients receiving hydroxyurea (HU), but no correlation with oxygenation, hemolysis, renal function, or inflammation was observed
25227310 EPO rs1617640 G homozygotes showed a significantly lower rise of serum EPO level over time than T allele carriers in hepatitis C patients undergoing antiviral therapy.
25194345 Suggest that the new reporter gene assay can be a viable supplement to the traditional reticulocyte assay and employed in potency determination of rHuEPO pharmaceutical products.
25175278 Novel findings suggest that the molecular mechanisms of EPO contribute to the progression and development of bladder tumors.
25084697 Cbl negatively regulates EPO signaling mainly through the proteasome-dependent degradation of Src, and the E3 ligase activity of Cbl and its tyrosine phosphorylation are regulated by Src but not Jak2.
25058943 This review gleans these different strategies and highlights the leading molecular recognition elements that have potential roles in rHuEPO doping detection.
25022958 in very preterm newborns, circulating levels of endogenous erythropoietin vary significantly with circulating levels of inflammation-related proteins.
25018619 The EPO concentration in the aqueous humor of familial amyloidotic polyneuropathy (FAP) and non-FAP patients, with and without glaucoma, was evaluated.
24907467 Telomere shortening caused by long term inhibition of the enzyme abolished the effect of EPO, suggesting that EPO effects on cancer cells are related to telomere dynamics.
24896364 Studies indicate that the signalling mediated by EPO is required for normal brain development.
24832733 investigated the mechanism of erythropoietin production by hypoxia in vitro using liver hepatocell (HepG2) cell line
24821155 Report frequency of EPO SNPs in diabetic nephropathy.
24796745 Data indicate that both classical and nonclassical pathway secretion vectors could express human IL-1beta in HepG2 cells, but erythropoietin(EPO) signal-peptide mediated classical pathway secreted much higher mature IL-1beta than that of nonclassical pathway.
24677652 AKT activation upregulates GATA-1 and FOXO3 transcriptional pathways with resulting inhibition of apoptosis, modulation of cell cycle, and enhanced maturation of erythroid cells.
24647661 These findings provide a framework for understanding that production of high levels of EPO induced by hypoxia also involves regulation at the translational level.
24504226 erythropoietin (EPO T --> G) and alpha-actinin-3 (ACTN3 R577X) polymorphisms have roles in nutrigenomic effects on athletes' performance, specifically antioxidant supplementation based on pequi oil
24412408 Studied the soluble overexpression of active rhEpo (recombinant erythropoietin) with various protein tags in E. coli, and found out that several tags increased the solubility of rhEpo.
24377712 Cardioprotective potentials of rhEpo are reviewed in this article by focusing on clinical applicability.
24307517 we demonstrated distribution of serum EPO levels in lower risk MDS cases with anemia, increasing levels of EPO levels according to progression of anemia.
24296452 Authors discussed:role and regulation of erythropoietin secretion, its extra-hematologic effect,concentration in normal and complicated pregnancy, placental secretion, its effect on placental function, its role in evaluation of fetal well-being.
24177168 Data indicate that the frequency of the -1125GG genotype in erythropoietin (EPO) was significantly lower in Graves' disease (GD) and suggest the -1125GG genotype of the EPO gene may be protective against the development of GD.
24165569 Erythropoietin (EPO) and its receptor (EPOR), frequently overexpressed in breast cancer, are true targets of miR-125b.
24144060 Amniotic fluid erythropoietin concentration is elevated in growth-restricted fetuses and could potentially be used for distinction between growth restricted and constitutionally small fetuses.
24100272 novel roles of autocrine/paracrine EPO-mediated cell signaling in regulating migration and invasion potential and stemness-like properties of breast cancer cells.
24052411 The main aim of this study was to investigate the dose-response relationship and determine the lowest effective dose of Erythropoietin(EPO) that reliably increases the osteogenic differentiation of human mesenchymal stromal cells (hMSCs).
23894012 Erythropoietin has a role in promoting the proliferation, survival and maturation of erythroblasts.
23881169 rHuEpo increased multiple-myeloma bone-marrow-derived macrophage-mediated production of pro-angiogenic factors. The Epo/Epo-R pathway may regulate the multiple myeloma angiogenic response.
23817218 An increased urinary EPO level in the early postnatal period is significantly associated with kidney and brain injury in critically ill neonates.
23788583 ADMA levels significantly increased during the observation time in EPO, EPO+recombinant tissue-type plasminogen activator (PA) and placebo groups in an EPO stroke trial.
23780896 Data indicate that expressions of PTHrP, EPO, and VEGF were respectively related to advanced stage of clear cell renal cell carcinoma (ccRCC).
23773177 Our data indicates that drug delivery systems should be optimized to deliver at least 36 mU/ml EPO into the eye since this dose was effective for the treatment of a progressive retinal degeneration.
23672497 Circulatory EPO may be a useful biomarker for coronary collateral development and potential target for therapeutic angiogenesis in patients with chronic total occlusion
23670359 Serum-EPO and the ratio between serum-EPO predicted and that observed declined progressively over time during scuba diving.
23661806 these results suggest that it is the renal CD133(+) progenitor cells that synthesize and release erythropoietin under hypoxia, via the prolyl hydroxylase-HIF-2alpha axis, in the human kidney.
23647063 Findings suggest that elevated hepcidin levels and inadequate erythropoietin response are frequent in diffuse large B-cell lymphoma (DLBCL), but elevated interleukin-6 (IL-6) plays the major role for the development of anemia.
23535151 Pretreatment with recombinant human erythropoietin elicited potent glomerular protection against cardiopulmonary bypass, partly due to downregulation of glomerular TRPC6-NFATc1 pathway.
23525596 Measurement of amniotic erythropoietin level combined with amniotic troponin-T level is effective for determining the severity of fetal hypoxia.
23403324 Data show that erythropoietin levels in homozygous Von Hippel-Lindau (VHL) H191D individuals are higher than in VHL R200W patients.
23401418 Serum EPO was significantly higher in infants living at high altitude compared to low altitude residents.
23393065 Dexamethasone abolished the rise in EPO induced by 8 h of hypoxia.
23337206 Indoxyl sulfate negatively regulates endothelial effects of erythropoietin through suppression of Akt phosphorylation.
23327923 MASL1 mRNA and protein expression levels were significantly increased during the erythroid differentiation of CD34(+) cells following erythropoietin treatment.
23313788 the EPO-EPOR system may play a role in glucose metabolism within adipocytes.
23242184 Identification of a novel ATF4 binding site within the EPO 3'-enhancer region, suggests a distinct role for ATF4 in the unfolded protein response-dependent suppression of the enhancer.
23227493 The mean serum EPO levels in patients with diabetic kidney lesion does not vary with the presence or absence of anemia, the degree of albuminuria, or glomerular filtration rate.
23180434 The ability of exogenous recoombinant human EPO to increase hemoglobin level appears to be impaired in patients with iron-refractory iron deficiency anemia (IRIDA) .
23158995 EPO/EPO-R expression and microvessel density are closely related, and expression of these two genes might be an endogenous stimulant of angiogenesis during the progression of non-small cell lung cancer.
23142737 Recombinant human EPO reduces astrocytic swelling created by oxygen-glucose deprivation followed by reoxygenation.
23142458 indicate that measurement of EGR1 gene expression in response to rHuEPO in UT-7/EPO cells offers a rapid, non-radioactive and automatable alternative for the detection of rHuEPO neutralizing antibodies (NAbs).
23142128 Results suggest a strong association between rs551238 and rs1617640 polymorphisms in the EPO gene and upper-limit haematocrit level among blood donors
23141213 EPO induces insulin-like growth factor-1 from 3D cultured human dermal papilla cells.
23052842 The progressive increase of EPO and EpoR mRNA can already be observed during the fibrotic-cirrhotic development with a peak of expression rising at tumor formation.
23028796 Epo/EpoR pathway was involved in cell growth, invasion, survival, and sensitivity to the multi-kinases inhibitor Sunitinib in renal cell carcinoma cells.
23027039 Considerable amounts of Epo are present in the ascitic fluid of women with ovarian tumors.
23016887 Subjects with metabolic syndrome have elevated serum erythropoietin levels.
22843933 these findings suggest a lack of influence of EPO rs1617640 G>T on early-stage breast carcinogenesis and clinical outcome.
22773876 a novel role for GATA-4 and TAL1 to affect skeletal myogenic differentiation and EPO response via cross-talk with Sirt1.
22768976 HCV positive HD patients have low levels of serum prohepcidin and IL-6 which might account for iron accumulation together with lower iron and rhuEPO requirements in these patients.
22669473 These findings reveal a role of endogenous EPO/EPOR for cognition, at least in schizophrenic patients.
22626952 I hypothesize that this nonrandom stroke distribution is related to regional differences in individual levels of erythropoietin (EPO), a hormone, which production depends on the tissue hypoxia due to variation in altitude.
22623897 smoking during pregnancy is associated with increased levels of umbilical cord erythropoietin at birth
22545469 The serum erythropoietin under intermediate B-thalassemia
22406924 Peginesatide and erythropoietin stimulate similar erythropoietin receptor-mediated signal transduction and gene induction events.
22388478 Erythropoietin prevents beta-amyloid degeneration of microglia via Wnt1/PI 3-K/mTOR/Bad/Bcl-xL pathway.
22351476 The glucose uptake was markedly increased by erythropoietin addition.
22167324 overview of current concepts of physiology of Epo with focus on role of Epo in retina in both normal conditions and in diabetic retinopathy [REVIEW]
22135724 HIF-1alpha may regulate the expression of EPO, which plays a favorable regulatory role in the proliferation and survival of human first-trimester trophoblast cells and decidual stromal cells
22025882 Data suggest that increased expression of erythropoietin and erythropoietin receptor may play a significant role in the carcinogenesis, angiogenesis and progression of gastric adenocarcinoma.
22021095 EPO may trigger AMPK-dependent signaling, which leads to enhanced phosphorylation of beta CRand eNOS, increased beta CR-AMPK-eNOS complex formation, NO production, and, ultimately, angiogenesis.
21926963 4 out of 15 (27%) of the multiple myeloma patients who developed myelodysplastic syndrome (MDS) had the G/G genotype, whereas only 2 out of 17 (12%) of the patients who did not develop MDS showed the G/G genotype.
21912616 the relation between erythropoietin (EPO) and malaria-attributable severe disease
21912181 The CC genotype of the EPO gene at position 3434 is more frequently found in patients with hypertension and is associated with higher blood pressure levels.
21898543 mTOR signaling plays an important role in Epo-mediated bone homeostasis.
21894032 Renal centers in England, Wales, and Northern Ireland report a higher dosage requirement in 2009 for erythropoietin stimulating agent in kidney transplant patients managed with hemodialysis therapy than for patients on peritoneal dialysis.
21847101 our study demonstrates that Epo gene-enhanced MSCs exert significant tissue protective effects in allogeneic mice with AKI, and supports the potential use of gene-enhanced cells as universal donors in acute injury.
21839094 The absence of glycosylation did not alter the folding mechanism of EPO but did greatly decrease the stability of the intermediate species, change the rate-limiting step of the folding reaction, and accelerate the folding kinetics.
21807323 EPO resistance is not associated with red blood cell distribution width in anemic patients with chronic heart failure and chronic kidney disease.
21757714 analysis of the role of specific domains in the different responsiveness of TRPC3 and TRPC6 to erythropoietin
21734083 In diabetic patients with chronic kidney disease, elevated endogenous EPO levels were predictive for mortality and were related mainly to markers of inflammation, independent of kidney function, and despite low hemoglobin levels.
21683736 EPO can prevent L-DOPA neurotoxicity by activating the PI3K pathway as well as reducing oxidative stress.
21623073 The uniform increase in the expression of Epo and EpoR along the colonic neoplastic sequence and further increase in ischemic/necrotic areas indicates that the Epo signaling pathway is an important component in colon carcinogenesis.
21619451 Flow cytometry was used for detection of pSTAT5 and CD95 expression in CD4+ T lymphocytes treated with recombinant human EPO.
21535154 EPO levels in anaemia of unknown cause were increased relative to controls but were inappropriately low for the degree of anaemia.
21334436 These data demonstrate that darbepoetin alfa suppresses TNF-alpha-induced ET-1 production through its antioxidant action and suggest that the sialic acid residues of darbepoetin alfa are essential for its antioxidant effect, possibly by scavenging ROS.
21321940 Suggest that beta common receptor may play an integrative role in the erythropoietin signaling-mediated activation of eNOS in endothelial cells.
21317243 The hEPO was expressed as a fusion to the IgG-Fc domain (EPO-Fc) and purified via protein A affinity chromatography.
21294852 Results indicate that a short period of normobaric oxygen breathing does not increase the erythropoietin concentration in aerobically fit healthy males.
21162115 A pharmacokinetic model is developed that predicts the time-dependent decline of epoetin alfa clearance following subcutaneous injections in anemic cancer patients.
21092038 Suggest that the EPO SNP rs1617640 plays a role in the development of renal dysfunction after cardiac surgery with cardiopulmonary bypass.
21078205 strong association between the rs1617640 G/G genotype and MDS
21078205 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21067572 Observational study of gene-disease association. (HuGE Navigator)
21042786 EPO was detected in 87.8% of sCCRCC tumours versus 7.3% for normal tissues. EPO expression was related to tumours demonstrating VHL gene abnormalities.
21033220 EPO expression (along with GLUT1 and Bcl-xl)plays a role in promoting self survival of malignant cells under hypoxic conditions of colorectal cancer.
20979939 Suggest the distal nephron as the major site of erythropoietin production, and support the notion that an inappropriate erythropoietin production is the cause of anemia in familial amyloidosis ATTR V30M.
20966191 In support, total serum haptoglobin levels were found to be significantly decreased at both days 8 and 16. Thus a 2DE proteomic approach for discovery of novel markers of Epo action appears feasible.
20947680 downregulation of sEPOR by intermittent hypoxia modulates the subsequent EPO response
20937240 Epo induced PTP1B cleaveage in TF-1 and differentiated UT-7 cells
20937006 elevation in cord blood may predict newborns at risk for intraventricular hemorrhage
20873225 transduction of human EPO into human bone marrow mesenchymal stromal cells synergistically enhances cell-protective and migratory effects.
20862521 No difference was revealed between levels of EPO in aqueous humor and serum in patients with pseudoexfoliation syndrome and pseudoexfoliative glaucoma.
20818790 The cytokine erythropoietin (EPO) is clinically used to treat anemia but has also been found to prevent gp120-induced neuronal death
20804540 These findings suggest that Epo is secreted by tumour cells and it affects vascular endothelial cells via its receptor and promotes angiogenesis in a paracrine manner, playing an important role in melanoma angiogenesis.
20729740 Suggest that endogenous erythropoietin production is suboptimal during antiviral therapy, supporting use of erythropoietic growth factors.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20614229 High Epo is associated with angiogenesis in glioma.
20566589 Levels of EPO and vascular endothelial growth factor are not associated with frequency of severe and mild hypoglycemia.
20395592 Findings support a new physiological and protective role for EPO, acting through its cell surface receptor and eNOS-Akt1 signal transduction, in matching cardiac mitochondrial mass to the convective O(2) transport capacity as erythrocyte mass expands.
20368990 p300 plays a central coactivator role in hypoxic induction of EPO
20353997 These data show that Epo induces phenotypic changes in the behavior of breast cancer cell lines and establishes links between individual cell signaling pathways and the potential for cancer spread.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20228410 Recombinant human erythropoietin has cardioprotective effects in maladaptive cardiac hypertrophy that inhibit nuclear factor-kappaB activation, p38-MAP kinase phosphorylation, and synthesis of tumor necrosis factor-alpha, together reducing apoptosis.
20179983 Case Report: Describe an 82-year-old man with erythrocytosis caused by an erythropoietin (EPO)-producing thymic carcinoma.
20164027 Expressions of EPO show mutual correlations in primary ductal breast cancers, which suggest co-operation among the protein.
20104680 Intermittent hypoxic exposure can enhance serum hypoxia inducible factor-1 alpha and erythropointin levels.
20091055 Case Report: Epoietin alfa-induced pure red cell anemia due to the generation of anti-EPO antibodies followed by endogenous erythropoietin production.
20065225 Identifying EPO genetic markers for high risk of developing diabetic retinopathy could lead to the possibility of developing novel treatments or preventive therapies.
20065225 Observational study of gene-disease association. (HuGE Navigator)
20012656 study found EPO level in serum was decreased, especially in patients with bulbar onset amyotrophic lateral sclerosis (ALS); a trend toward a progressive EPO decline with the duration of the disease in the mild + moderate ALS cases was observed
19955699 plasma levels reduced during exacerbations of chronic obstructive pulmonary disease, likely in relation to a burst of systemic inflammation
19932158 Demonstrate the feasibility of PEGylating recombinant human non-glycosylated Epo to enhance protein stability and prolong circulating half life.
19930602 Cells within the brainstem of severe malaria patients showed protein expression of Epo and its receptor components. However, the incidence of endogeneous expression did not reflect protection from vascular or neuronal injury
19913121 Observational study of gene-disease association. (HuGE Navigator)
19901910 EPO prevents musculocutaneous tissue from ischemic necrosis as a consequence of an eNOS-dependent arteriolar hyperperfusion maintaining capillary perfusion. A promising approach to pharmacologically protect ischemically challenged tissue.
19890342 SGA(small for gestational age) and normal term infants had similar cord blood Hepcidin concentrations, but EPO (erythropoietin) levels were significantly higher in the SGA group
19804771 Data show that HIF-1 alpha mRNA expression increases in newborn infants with persistent pulmonary hypertension of the newborn or cyanotic congenital heart disease, as does the expression of its target genes VEGF and EPO.
19766721 Recombinant human EPO protects rat kidneys against acute cyclosporine nephrotoxicity by activating antiapoptotic pathways.
19690392 Show the time-dependent increase of serum EPO in acute myocardial infarction patients after primary PCI, indicating its possible contribution to cardioprotective effect in the chronic phase.
19619913 Tubulo-interstitial damage with low levels of EPO occurs early in Type 1 and Type 2 diabetes before persistent microalbuminuria.
19602911 The vitreous EPO level was upregulated in eyes with rhegmatogenous retinal detachment and proliferative vitreoretinopathy .
19515792 Signaling through EPOR is involved in exercise-induced skeletal muscle adaptation, thus extending the biological role of EPO into the skeletal muscle.
19463769 At baseline, increased levels of MIP-1 alpha were associated with increased graft vascular progenitors while higher EPO concentrations on the day of PBSC collection predicted higher graft vascular progenitors levels
19375648 regulation of erythropoiesis is operated by low O(2) concentrations, beyond the EPO/EPO-responsive cells loop and provide a tool to optimize the technology for ex vivo production of RBC.
19375647 GR became associated with the EPO receptor and STAT-5 in cells stimulated with EPO and DXM
19339771 For the first time, we report erythropoietin-positive immunoreactivity in liver adenomatous cells in a patient with erythrocytosis.
19321698 Sex-dependent regulation of hypoxic ventilation in mice and humans is mediated by erythropoietin.
19269703 Elevated erythropoietin level was associated with increased mortality in patients admitted with possible acute coronary syndrome when adjusted for clinical variables, or for kidney function and hemoglobin
19211168 Hypoglycaemia triggers a rise in plasma erythropoietin in patients with type 1 diabetes, which may carry a neuroprotective effect during hypoglycemia.
19165176 molecular aspects of EPO gene regulation by hypoxia-inducible transcription factors and the tissue-specific regulation of EPO production [review]
19136057 protects retinal pigment epithelial cells from oxidative damage
19074769 TRPC6 regulates TRPC3 activation by Epo
19070519 Up-regulation of of erythropoietin receptor has a more important role in comparison with of erythropoietin in prostate carcinogenesis.
19042077 A strong positive correlation exists between amniotic fluid S100B and erythropoietin concentrations in pregnancies at high risk for chronic fetal hypoxia.
19027957 our data support the premise that DCs are direct targets of EPO, thereby providing an insight to the immunomodulatory functions of EPO.
19014520 Observational study of gene-disease association. (HuGE Navigator)
18928604 The levels of EPO, SCF and GM-CSF in chronic aplastic anemia patients were obviously lower than those in the healthy individuals.
18922618 DCs are directly affected by EPO renders them as potential candidates that mediate the immunomodulatory actions of EPO.
18787502 Observational study of gene-disease association. (HuGE Navigator)
18722069 ABELLA for the sialylated recombinant EPO present in CHO culture supernatant is reported.
18586515 Recombinant human EPO does not effect survival or the polarized morphology of hippocampal neurons but its effect on neurite outgrowth depends upon the stage of polarization.
18544472 decreased EPO levels in familial amyloidosis TTR V30M correlated with the prohepcidin levels
18533563 The level of EPO in OSAHS patients is higher than that in normal adults. The level of EPO in preoperative patients was significantly higher than in postoperative patients.
18479804 expression in placenta increased in abortive tissue and hydatidiform mole
18458324 These results suggest that rs1617640 in the EPO promoter is significantly associated with proliferative diabetic retinopathy (PDR) and end stage renal disease.
18458324 Observational study of gene-disease association. (HuGE Navigator)
18414140 in newborn cord blood, the higher number of red cells and reticulocytes with lower Hb content may have impaired the oxygen carrying capacity that has been a trigger for EPO production
18399174 TNF-alpha might inhibit EPO production and erythropoiesis, while IFN-gamma may directly inhibit erythropoiesis and be independent of EPO response inadequacy in cancer patients with anemia.
18356745 Epo mRNA and protein concentrations increase with increasing gestational age and are greater in the vitreous than serum. Changes in Epo production following preterm delivery might affect retinal vascular development.
18332162 Epo overexpression is an early event in the retina of diabetic patients.
18278456 EPO and EPO Receptor have roles in apoptosis in pancreatic cells
18276585 TRPC3 Tyr(226) is critical in Epo-dependent activation of TRPC3
18259195 In hippocampal neurons, Stat5 is not required for neuroprotection by EPO but is, together with Akt essential for its neurotrophic activity.
18219110 study shows breast epithelial cells are a source of Epo in breast microenvironment, suggesting presence of a paracrine/autocrine Epo function in Nipple Aspirate Fluids, triggering intracellular signaling cascade with subsequent breast cancer initiation
18201556 In vitro biological activity of egg white-hEpo was comparable to that produced by recombinant CHO cells.
18189270 rHuEpo injection reduced the peritoneal exudate macrophages iron retention. The uptake of Fe(II) was decreased via the suppression of DMT1 (+IRE) expression and the release of Fe(II) was increased with increasing the expression of FPN1 in macrophages.
18160550 Erythropoietin levels in cord blood were not different between preterm infants with and without periventricular leukomalacia.
18093155 Administration of rhEPO protects neurons by enhancing Bcl-2 expression, thereby inhibiting traumatic brain injury-induced neuronal apoptosis.
18091448 aqueous humor EPO level is increased in eyes with primary open-angle glaucoma.
18086112 Recombinant erythropoietin promotes hepatic regeneration after extended liver resection in rats.
18074690 Recovery of neurological function in a model of peripheral nerve injury is more rapid with weekly administration of darbepoetin alfa than with daily recombinant human erythropoietin treatment.
17984928 Erythropoietin levels in the familial cases of restless leg syndrome were significantly lower than in the reference population.
17952604 results suggest that PI3K/Akt and GSK-3beta pathway are involved in the neuroprotective effect of EPO
17893875 Epo has a role in reducing expression of apoptosis-related proteins Bcl-2 and Bcl-10 in ovarian cancer cells
17893874 erythropoietin receptor and erythropoietin have roles in the autocrine/paracrine mechanism of growth enhancement in human ovarian cancer cells
17888545 Overall, our data argue against the hypothesis of EPO as a genetic risk factor for motor neuron dysfunction, at least in Italian population. However, more studies on larger cohort are needed to confirm the evidence of EPO gene as modifier factor.
17888545 Observational study of gene-disease association. (HuGE Navigator)
17873970 EPO protects the intestine against ischemia/reperfusion injury in rats.
17713555 hTERT appears to be efficiently regulated by EPO and TGFbeta in an opposite way in erythropoietic cells, arguing for a role of telomerase in red blood cell production
17652365 The impact of Epo overexpression in mice and the resulting excessive erythrocytosis in the neural control of normoxic and hypoxic ventilation is reported.
17647284 Epo and EpoR were expressed neuroblastomas but did not modify tumor cell proliferation.
17645631 Erythropoietin has a significant angiogenic effect in rat kidney with cyclosporine A-induced nephrotoxicity.
17636183 Review. Epo exhibits a "tissue-protective" effect on nonhematopoietic tissues, possibly mediated through a novel heteroreceptor, blocking apoptosis by a variety of insults. However, Epo may have a potential direct growth-promoting action on cancer cells.
17615151 EPO contributes to regulation of hypothalamo-pituitary-adrenal (HPA) axis activation; in pathological conditions such as brain ischemia, this growth factor may control HPA axis function, preventing possible detrimental effects of HPA overactivation.
17597020 Statistically analyzed distributions of the proteins reflected functional dependences among STAT3, HIF-1alpha, EPO and EPOR in cellular signal conduction.
17577097 Erythopoietin confers immediate and sustained protection of the heart against injury from ischemia/reperfusion by a mechanism involving activation of protein kinases and ATP-dependent potassium channels.
17540710 Data show that human scalp hair follicles express erythropoietin (EPO), up-regulate EPO transcription under hypoxic conditions, and express transcripts for EPO receptors and the EPO-stimulatory transcriptional cofactor hypoxia-inducible factor-1alpha.
17481772 Blockade of Epo inhibits retinal neovascularization in vivo, and inhibits endothelial cell proliferation response in diabetic reginopathy.
17467346 Review discusses studies on EPO circadian, monthly and even annual variations; studies in connection with short-, medium- and long-term exercise at sea-level and studies performed at moderate and high altitude [review].
17442163 Oxidative stress induces a significant increase of EPO expression in retinal pigment epithelium cells.
17395782 Adaptive mechanisms to hematocrit levels of erythropoietin-overexpressing transgenic mice show increased plasma nitric oxide levels and erythrocyte flexibility.
17389738 rhEPO treatment inhibits the progression of renal fibrosis in obstructed kidney and attenuates the TGF-beta1-induced epithelial-to-mesenchymal transition.
17372034 EPO prevents aberrant remodeling of the injured carotid artery. The protective effects of EPO are critically dependent on activation of eNOS.
17360900 Epo increases hippocampus response during picture retrieval compared with placebo independent of changes in hematocrit.
17145806 Cervical cancers with higher Epo expression showed a significantly reduced overall survival and correlated significantly with apoptosis.
17081058 Lysine-containing peptides comprising glycosylation sites derived from recombinant human erythropoietin were derivatized with 2-methoxy-4,5-dihydro-1H-imidazole and its deuterated analogues.
17045782 A "classical" homodimeric erythropoietin receptor is essental for the antiapoptotic effects of Epo on differentiated neuroblastoma SH-SY5Y cells.
16936148 Erythropoietin is expressed in the human retina, and it is upregulated in diabetic patients even without retinopathy.
16909043 EPO, at pharmacological concentrations, can activate three major signalling cascades, viz. the Jak2/STAT5, Ras/ERK and PI3K/Akt pathways in non-small cell lung carcinoma (NSCLC) cell lines
16883594 The effect of 2-oxoglutarate on the production of erythropoietin and vascular endothelial growth factor (VEGF), was examined.
16838166 bicycle taxi drivers with subclinical lead toxicity have decreased serum EPO
16699298 findings show that three thyroid cancer cell lines expressed Epo and EpoR mRNA and that the hypoxia-mimetic cobalt induced Epo expression
16684536 NF-kappaB is probably the primary transcription factor by which cAMP counteracts the inhibition of Epo gene expression by IL-1.
16645141 Epo treatment inhibits neointimal hyperplasia after arterial injury in NO-dependent manner by acting on injured vessels and mobilizing endothelial progenitor cells to neo-endothelium.
16627979 Coexpression of erythropoietin and its receptor plays a important role in tumorigenesis of sporadic clear cell renal cell carcinoma.
16475009 Recombinant human EPO (rhEPO) derived from transgenic mouse milk displays biological activity that is at least comparable to therapeutic and/or commercial rhEPO, both in vitro and in vivo.
16467207 Binding of the transcriptionally competent Wt1(-KTS) isoform to the minimal EPO promoter was demonstrated; this promoter was activated up to 20-fold by transient cotransfection of Wt1(-KTS) in different cell lines.
16332412 Therefore, rhEPO could be an effective drug for the prevention of hearing loss via a hair cell protective mechanism.
16286456 Epo is degraded faster than NESP at the cellular level
16278379 Erythropoietin and erythropoietin receptor are expressed in head and neck squamous cell carcinoma
16229477 under a variety of conditions rEPO undergoes thermal or urea-induced denaturation that may be considered as a reversible two-state process characterized by unusually high (thermal) or moderate (urea-induced) extent of the residual structure
16123502 Elevated in vitreous fluid of patients with proliferative diabetic retinopathy.
15993382 In conclusion, erythropoietin may attenuate high glucose-induced endothelial cell apoptosis via PI-3 kinase pathway.
15988318 Multiple logistic regression revealed a significant association between the appearance of nucleated RBCs in the blood and erythropoietin, IL-3, IL-6, and age.
15967106 Erythropoietin signaling has a role in promoting invasiveness of human head and neck squamous cell carcinoma
15856028 results define a novel role for EPO in mediating tumor cell invasion; increased levels of EPO/EPOR in lymph node metastases as compared to primary tumors from HNSCC patients further support the role of EPO/EPOR in HNSCC disease progression and metastasis
15795697 Hemoglobin and serum EPO levels were significantly higher in the chronic obstructive lung disease group than in pulmonaary fibrosis patients and controls.
15777837 the erythropoietin functions that promote cell survival and proliferation are affected by aluminum exposure through mechanisms involving erythropoietin receptor
15769989 Coexpression of Erythropoietin and Erythropoietin receptor was found in all five Hippel Lindau disease-associated pheochromocytomas.
15743794 autocrine and paracrine functions of Epo might play a role in malignant transformation of melanocytes and in the survival of melanoma cells in hypoxia
15728783 Recombinant human erythropoietin treatment of endothelial cells causes a significant increase in asymmetric dimethylarginine (ADMA) levels in the cell culture medium.
15718359 EPO may have a role in oxygenation during gestation and placental sufficiency, as seen in this study of monozygotic and dizygotic twins' cord blood analysis
15709172 Results showed that VHL disease-associated renal clear cell carcinomas and renal cysts coexpress erythropoietin and erythropoietin receptor.
15709164 erythropoietin was expressed in one half of samples by immunohistochemistry and in 100% of samples by mRNA detection in non-small cell lung carcinomas.
15705187 in vivo EPO does not affect the functionality and/or production of components of the VEGF/Flt-1 system in diabetics with normal or reduced renal function.
15671524 erythropoietin and EPOR are co-expressed in tumor cells, suggesting that erythropoietin may potentially function as an autocrine or paracrine factor in head and neck cancer
15627795 Angiotensin II does not alter EPO production in HepG2 cell culture under normoxic or hypoxic conditions.
15590452 Further investigations are needed to understand the mechanism of the hepatoprotective effect of erythropoietin and the clinical importance of ischemic liver injury in the fetus.
15502930 Prenatal high amniotic fluid erythropoietin levels can identify type 1 diabetic pregnancies at increased risk of severe perinatal complications.
15467711 Epression of erythropoietin in prostate cancer cell lines suggesting that these cells may serve as useful experimental models for further studies of erythropoietin function for growth regulation in prostate cancer.
15389732 erythropoietin has a protective role against cancer and brain injury [review]
15363820 Increased erythropoietin may be a potential reversible mechanism to explain the association between obstructive sleep apnea and cardiovascular disease.
15347669 Brahma and Brahma/SWI2-related gene 1 have roles in hypoxic induction of the erythropoietin gene
15339684 The performance-enhancing effect of recombinant erythropoietin treatment is greater than the duration and diagnosis of hematologic changes associated with recombinant erythropoietin misuse.
15257091 erythropoietin has a role in healing of ischemic skin wounds
15240563 the complete EPO enhancer displayed dependency on HIF-2alpha regulation, indicating that additional cis-acting elements confer HIF-2alpha specificity within this region
15210945 EPO+IGF-I exert cooperative actions that afford acute neuroprotection via activation of the PI3-K-Akt pathway
15205261 erythropoietin and hypoxia stimulate erythropoietin receptor and nitric oxide production in vascular endothelial cells
15183662 Initial studies of recombinant erythropoietin as therapy for infants with neurologic injury are encouraging. Review.
15160341 Increased erythropoietin expression is associated with endometrial carcinoma
15142852 EPO is important for development of the brain and is neuroprotective, whereas it stimulates angiogenesis in the reproductive tract and possibly in other organs--REVIEW
15112358 Results show no significant difference in erythropoietin values between non-anemic patients with liver disease and controls.
15073510 The cytokine erythropoietin (EPO) is clinically used to treat anemia but has also been found to prevent gp120-induced neuronal death
15053948 Review summarizes current knowledge of the nonerythropoietic roles of Epo, its neurotrophic and neuroprotective properties, the mechanisms by which Epo produces neuroprotection and the signal transduction systems regulated by Epo in the nervous system.
15019812 Erythropoietin protein was constitutively present in seminal plasma. The seminal EPO originated from the prostate and seminal vesicle. No association between EPO levels in seminal plasma and sperm parameters was found.
14990112 EPO levels increased incompensatively in anemia of chronic disease (ACD) children, which may be a cause of ACD.
14755373 Erythropoietin deficiency may be one of the endocrine abnormalities associated with autoimmune polyglandular syndrome type I.
14747752 Results show that recombinant human erythropoietin reduces brain injury, especially apoptotic cell death, after neonatal hypoxia-ischemia.
14724429 Overexpression of EPO protects islets from destruction and does not compromise islet function. Genetic engineering with EPO may improve islet survival and engraftment in transplant setting, but regulation of gene expression will be important prerequisite.
14704034 EPO stimulation significantly increased the level of Akt phosphorylation, the downstream target of PI3-kinase.
14671634 after rHuEpo stimulation in the chick embryo chorioallantoic membrane assay, the generation of new blood vessels occurred more frequently following an intussusceptive microvascular growth mechanism
14584755 Only a minority of papillary thyroid carcinomas (PTC) expressed EPO, and there were no significant differences between the PTC that did or did not express EPO.
14583613 GATA-4 is critical for transcription of the Epo gene in hepatocytes and may contribute to the switch in the site of Epo gene expression from the fetal liver to the adult kidney
12975460 These findings suggest that recombinant human erythropoietin (EPO) attenuates ischemia-induced inflammation by reducing neuronal death rather than by direct effects upon EPO-receptor-expressing inflammatory cells.
12937140 Novel function for EPO by providing in vivo evidence for a physiological role during fibrin-induced wound healing.
12829027 protein CBP/p300 was shown to be essential for EPO- and SCF-mediated STAT5 transactivation
12801298 hemoglobin levels are related to the rise in serum EPO that occurs during pregnancy
12759237 Results suggest that increased expression of erythropoietin may play a significant role in cervical carcinogenesis and tumor progression.
12734640 Inhibition of erythropoietin(Epo) gene expression by cadmium depends on suppression of hypoxia-inducible factor 1(HIF-1) binding activity.
12525458 Epo and Epo-R localized within glandular epithelial cells in both peritoneal endometriosis and eutopic endometrium. Role in pathophysiology of endometriosis.
12482504 a key role for NF-kappaB in EPO gene regulation in response to hypoxia
12476588 may play an important role in signal transduction via EpoR on erythroid progenitor in CRF patients.
12463751 Direct comparison of nonglycosylated vs. glycosylated EPO demonstrates how both carbohydrate core structure and sialic acid can dampen electrostatic contributions to receptor association rate constant with little effect on dissociation rate.
12419827 erythropoietin signalling contributes to the growth and/or survival of both transformed cells and capillary endothelial cells in female reproductive system tumours.
12381912 All regions of kidney express erythropoietin receptors. Review.
12362243 triggers a signaling pathway (MAPK p42/44) in vascular endothelial cells and increases the thrombogenicity of their extracellular matrices
12239177 hypoxia-inducible gene expression in human neuroblastoma cells
12207089 REVIEW: pathways by which transcription of erythropoietin is regulated by availability of molecular oxygen
12187026 data suggest that although chronic lymphocytic leukemia (CLL) anemia is not characterized by inadequate Epo production, in some CLL patients this factor may be correlated; in these cases, levels of TNF-alpha were higher than in other anemic cases
12171772 Increased levels of circulating thrombopoietin were found in patients with clonal thrombocytosis versus patients with reactive thrombocytosis, indicating a potential differential diagnosis tool.
12091337 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
11994541 While both Epo and Epo-R were detected in all samples of isolated epithelial cells analysed throughout the menstrual cycle, neither one was detected in isolated stromal cells. Epo and Epo-R protein expression in glandular epithelial cells was increased
11920206 Two to three weeks after initiation of hydroxyurea treatment, the sEpo values started to increase and reached levels three to 31 times higher than the baseline two to three weeks later.
11919332 Data suggest that erythropoietin may be an endogenous stimulant of blood vessel growth during neonatal gastrointestinal development.
11906322 Influence of controlled hypoxia and radical scavenging agents on erythropoietin and malondialdehyde concentrations in humans.
11906321 Serum erythropoietin levels (s-[epo]), haemoglobin concentration ([Hb]), haematocrit (hct), and ferritin concentration ([fer]) were measured in seven healthy male volunteers (20-23 years) exposed continuously to hypoxia (PO(2) 14 kPa) for 10 days
11869305 renal failure patients mounted an EPO response to hypoxia but at lower EPO levels
11865075 Erythropoietin, tumours and the von Hippel-Lindau gene: towards identification of mechanisms and dysfunction of oxygen sensing.
11861258 Carbohydrate content and structure of EPO are important determinants in their half-life in the circulation.
11854521 used a transient global spinal ischemia model in rabbits to test whether exogenous EPO can cross the blood-spinal cord barrier and protect these motor neurons.

AA Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPD      1 - 70
TKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALG     71 - 140
AQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR                     141 - 193
//

Text Mined References (331)

PMID Year Title
27081163 2016 PlanHab: Hypoxia counteracts the erythropoietin suppression, but seems to exaggerate the plasma volume reduction induced by 3 weeks of bed rest.
26995951 2015 [REGULATION OF EXTRARENAL ERYTHROPOIETIN PRODUCTION].
26838000 A study on biochemical facet of anemia in cancers: A strong link between erythropoietin and tumor necrosis factor alpha in anemic cancer patients.
26721912 2016 Association of Serum Erythropoietin With Cardiovascular Events, Kidney Function Decline, and Mortality: The Health Aging and Body Composition Study.
26469975 2016 Erythropoietin protects the tubular basement membrane by promoting the bone marrow to release extracellular vesicles containing tPA-targeting miR-144.
26447159 2015 Vitamin D status is inversely associated with anemia and serum erythropoietin during pregnancy.
26412593 2015 Human rhabdomyosarcoma cells express functional erythropoietin receptor: Potential therapeutic implications.
26261574 2015 rhEPO affects apoptosis in hippocampus of aging rats by upregulating SIRT1.
26097591 2015 Erythropoietin and erythropoietin receptor in hepatocellular carcinoma: correlation with vasculogenic mimicry and poor prognosis.
26049959 2015 [Blunted erythropoietic response in the anemia of anorexia nervosa].
26012423 2015 Cooperative Effect of Erythropoietin and TGF-? Inhibition on Erythroid Development in Human Pluripotent Stem Cells.
25966953 2015 Erythropoietin dampens injury-induced microglial motility.
25887776 2015 Emerging EPO and EPO receptor regulators and signal transducers.
25793991 2015 Elevated endogenous erythropoietin concentrations are associated with increased risk of brain damage in extremely preterm neonates.
25786542 2015 Erythropoietin gene expression: developmental-stage specificity, cell-type specificity, and hypoxia inducibility.
25724399 2015 Aberrant expression of erythropoietin in uterine leiomyoma: implications in tumor growth.
25675872 2015 Association of erythropoietin gene polymorphisms with retinopathy in a Chinese cohort with type 2 diabetes mellitus.
25656761 2015 Genetic disposition and modifiable factors independently associated with anemia in patients with type 2 diabetes mellitus.
25630969 2015 Erythropoietin directly stimulates osteoclast precursors and induces bone loss.
25628168 2015 Nonspecific shielding of unfavorable electrostatic intramolecular interactions in the erythropoietin native-state increase conformational stability and limit non-native aggregation.
25477265 2015 Elevated erythropoietin and cytokines levels are related to impaired reticulocyte maturation in thalassemic patients.
25405915 2014 Erythropoietin levels in patients with sickle cell disease do not correlate with known inducers of erythropoietin.
25227310 2014 Erythropoietin rs1617640 G allele associates with an attenuated rise of serum erythropoietin and a marked decline of hemoglobin in hepatitis C patients undergoing antiviral therapy.
25194345 2014 A novel reporter gene assay for recombinant human erythropoietin (rHuEPO) pharmaceutical products.
25175278 2014 EPO gene expression induces the proliferation, migration and invasion of bladder cancer cells through the p21WAF1?mediated ERK1/2/NF-?B/MMP-9 pathway.
25084697 2014 Cbl negatively regulates erythropoietin-induced growth and survival signaling through the proteasomal degradation of Src kinase.
25058943 2015 Monitoring recombinant human erythropoietin abuse among athletes.
25022958 2014 Endogenous erythropoietin varies significantly with inflammation-related proteins in extremely premature newborns.
25018619 2014 Aqueous humor erythropoietin levels in open-angle glaucoma patients with and without TTR V30M familial amyloid polyneuropathy.
24907467 2014 The effects of erythropoietin signaling on telomerase regulation in non-erythroid malignant and non-malignant cells.
24896364 2014 From neurogenesis to neuroprotection in the epilepsy: signalling by erythropoietin.
24832733 2014 Reevaluation of erythropoietin production by the nephron.
24821155 2014 Single nucleotide polymorphisms at erythropoietin, superoxide dismutase 1, splicing factor, arginine/serin-rich 15 and plasmacytoma variant translocation genes association with diabetic nephropathy.
24796745 2014 [The expression of human IL-1? gene containing human erythropoietin signal peptide in HepG2 cells].
24677652 2014 Erythropoiesis from human embryonic stem cells through erythropoietin-independent AKT signaling.
24647661 2014 Translation of the human erythropoietin transcript is regulated by an upstream open reading frame in response to hypoxia.
24504226 2013 The influence of erythropoietin (EPO T ? G) and ?-actinin-3 (ACTN3 R577X) polymorphisms on runners' responses to the dietary ingestion of antioxidant supplementation based on pequi oil ( Caryocar brasiliense Camb.): a before-after study.
24412408 2014 Soluble expression and partial purification of recombinant human erythropoietin from E. coli.
24377712 2014 Erythropoietin and the heart: physiological effects and the therapeutic perspective.
24307517 2014 Distribution of serum erythropoietin levels in lower risk myelodysplastic syndrome cases with anemia.
24296452 The role and regulation of secretion of erythropoietin in pregnancy.
24177168 The GG genotype of the -1125G/T polymorphism in the EPO gene protects against the development of Graves' disease.
24165569 2013 miR-125b targets erythropoietin and its receptor and their expression correlates with metastatic potential and ERBB2/HER2 expression.
24144060 2014 Erythropoietin in amniotic fluid as a potential marker in distinction between growth restricted and constitutionally small fetuses.
24100272 2014 Autocrine/paracrine erythropoietin regulates migration and invasion potential and the stemness of human breast cancer cells.
24052411 2014 The osteogenic effect of erythropoietin on human mesenchymal stromal cells is dose-dependent and involves non-hematopoietic receptors and multiple intracellular signaling pathways.
23894012 2013 Erythropoietin critically regulates the terminal maturation of murine and human primitive erythroblasts.
23881169 2013 Erythropoietin is involved in the angiogenic potential of bone marrow macrophages in multiple myeloma.
23817218 2013 Urine erythropoietin level is associated with kidney and brain injury in critically ill neonates.
23788583 2013 Asymmetric dimethylarginine in response to recombinant tissue-type plasminogen activator and erythropoietin in acute stroke.
23780896 2013 Paraneoplastic hormones: parathyroid hormone-related protein (PTHrP) and erythropoietin (EPO) are related to vascular endothelial growth factor (VEGF) expression in clear cell renal cell carcinoma.
23773177 2013 Identification of a therapeutic dose of continuously delivered erythropoietin in the eye using an inducible promoter system.
23672497 2013 Serum erythropoietin: a useful biomarker for coronary collateral development and potential target for therapeutic angiogenesis among the patients with coronary chronic total occlusion.
23670359 2013 EPO modulation in a 14-days undersea scuba dive.
23661806 2013 Renal CD133(+)/CD73(+) progenitors produce erythropoietin under hypoxia and prolyl hydroxylase inhibition.
23647063 2014 Anemia in diffuse large B-cell non-Hodgkin lymphoma: the role of interleukin-6, hepcidin and erythropoietin.
23535151 2013 Recombinant human erythropoietin pretreatment alleviates renal glomerular injury induced by cardiopulmonary bypass by reducing transient receptor potential channel 6-nuclear factor of activated T-cells pathway activation.
23525596 2013 Analysis about the influence on the fetus infected with parvovirus B19 using amniotic erythropoietin and troponin-T.
23403324 2013 The phenotype of polycythemia due to Croatian homozygous VHL (571C>G:H191D) mutation is different from that of Chuvash polycythemia (VHL 598C>T:R200W).
23401418 2013 Increased lung volume in infants and toddlers at high compared to low altitude.
23393065 2013 Dexamethasone mimics aspects of physiological acclimatization to 8 hours of hypoxia but suppresses plasma erythropoietin.
23337206 2013 Indoxyl sulfate counteracts endothelial effects of erythropoietin through suppression of Akt phosphorylation.
23327923 2013 MASL1 induces erythroid differentiation in human erythropoietin-dependent CD34+ cells through the Raf/MEK/ERK pathway.
23313788 2013 Erythropoietin improves insulin resistance via the regulation of its receptor-mediated signaling pathways in 3T3L1 adipocytes.
23242184 2013 Endoplasmic reticulum stress signal impairs erythropoietin production: a role for ATF4.
23227493 2012 [Early erythropoietin deficiency in diabetic kidney lesion].
23180434 2013 Administration of recombinant erythropoietin alone does not improve the phenotype in iron refractory iron deficiency anemia patients.
23158995 2012 [Expression of erythropoietin and erythropoietin receptor in non-small cell lung cancer and its correlation with microvessel density].
23142737 2013 Protective effects of erythropoietin on astrocytic swelling after oxygen-glucose deprivation and reoxygenation: mediation through AQP4 expression and MAPK pathway.
23142458 2013 Detection of neutralizing antibodies to erythropoietin by inhibition of rHuEPO-stimulated EGR1 gene expression in the UT-7/EPO cell line.
23142128 2012 Association between polymorphisms in erythropoietin gene and upper limit haematocrit levels among regular blood donors.
23141213 2013 Erythropoietin induces insulin-like growth factor-1 from three-dimensional culture of human dermal papilla cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23052842 2013 Characterization of the erythropoietin/erythropoietin receptor axis in a rat model of liver damage and cholangiocarcinoma development.
23028796 2012 The erythropoietin/erythropoietin receptor signaling pathway promotes growth and invasion abilities in human renal carcinoma cells.
23027039 2012 Erythropoietin is detectable in the ascitic fluid in patients with ovarian tumors.
23016887 2012 Erythropoietin, ferritin, haptoglobin, hemoglobin and transferrin receptor in metabolic syndrome: a case control study.
22843933 2012 The functional polymorphism of erythropoietin gene rs1617640 G>T is not associated with susceptibility and clinical outcome of early-stage breast cancer.
22773876 2012 GATA-binding protein 4 (GATA-4) and T-cell acute leukemia 1 (TAL1) regulate myogenic differentiation and erythropoietin response via cross-talk with Sirtuin1 (Sirt1).
22768976 2012 Lower serum prohepcidin levels associated with lower iron and erythropoietin requirements in hemodialysis patients with chronic hepatitis C.
22669473 2012 Common variants of the genes encoding erythropoietin and its receptor modulate cognitive performance in schizophrenia.
22626952 2012 The role of erythropoietin in the "stroke belt" phenomenon.
22623897 2012 Umbilical cord serum erythropoietin levels and maternal smoking in pregnancy.
22545469 2012 [The serum erythropoietin under intermediate B-thalassemia].
22406924 2012 Peginesatide and erythropoietin stimulate similar erythropoietin receptor-mediated signal transduction and gene induction events.
22388478 2012 Prevention of ?-amyloid degeneration of microglia by erythropoietin depends on Wnt1, the PI 3-K/mTOR pathway, Bad, and Bcl-xL.
22351476 2012 Effects of erythropoietin on glucose metabolism.
22167324 2012 Erythropoietin produced by the retina: its role in physiology and diabetic retinopathy.
22135724 2011 EPO improves the proliferation and inhibits apoptosis of trophoblast and decidual stromal cells through activating STAT-5 and inactivating p38 signal in human early pregnancy.
22025882 2011 Prognostic significance of erythropoietin and erythropoietin receptor in gastric adenocarcinoma.
22021095 2012 AMP-activated protein kinase mediates erythropoietin-induced activation of endothelial nitric oxide synthase.
21926963 2012 Polymorphism of the erythropoietin gene promotor and the development of myelodysplastic syndromes subsequent to multiple myeloma.
21912616 2011 Erythropoietin levels are not independently associated with malaria-attributable severe disease in Mozambican children.
21912181 2012 An erythropoietin gene polymorphism in the hypoxia-responsive element at position 3434 is possibly associated with hypertension.
21898543 2012 Erythropoietin mediated bone formation is regulated by mTOR signaling.
21894032 2011 UK Renal Registry 13th Annual Report (December 2010): Chapter 9: haemoglobin, ferritin and erythropoietin amongst UK adult dialysis patients in 2009: national and centre-specific analyses.
21847101 2011 Erythropoietin gene-enhanced marrow mesenchymal stromal cells decrease cisplatin-induced kidney injury and improve survival of allogeneic mice.
21839094 2011 The effect of glycosylation on the folding kinetics of erythropoietin.
21807323 2011 Determinants of red cell distribution width (RDW) in cardiorenal patients: RDW is not related to erythropoietin resistance.
21757714 2011 The transient receptor potential (TRP) channel TRPC3 TRP domain and AMP-activated protein kinase binding site are required for TRPC3 activation by erythropoietin.
21734083 2011 Endogenous erythropoietin and the association with inflammation and mortality in diabetic chronic kidney disease.
21683736 2011 L-DOPA neurotoxicity is prevented by neuroprotective effects of erythropoietin.
21623073 Expression of erythropoietin and its receptor increases in colonic neoplastic progression: the role of hypoxia in tumorigenesis.
21619451 2011 Flow cytometric analysis of STAT5 phosphorylation and CD95 expression in CD4+ T lymphocytes treated with recombinant human erythropoietin.
21535154 2011 Erythropoietin, GDF15, IL6, hepcidin and testosterone levels in a large cohort of elderly individuals with anaemia of known and unknown cause.
21334436 2011 Darbepoetin alfa suppresses tumor necrosis factor-?-induced endothelin-1 production through antioxidant action in human aortic endothelial cells: role of sialic acid residues.
21321940 2011 ? Common receptor integrates the erythropoietin signaling in activation of endothelial nitric oxide synthase.
21317243 2011 N-glycosylation engineering of plants for the biosynthesis of glycoproteins with bisected and branched complex N-glycans.
21294852 2011 Acute normobaric hyperoxia transiently attenuates plasma erythropoietin concentration in healthy males: evidence against the 'normobaric oxygen paradox' theory.
21162115 2011 Non-linear mixed effect modeling of the time-variant disposition of erythropoietin in anemic cancer patients.
21092038 2010 Relation between renal dysfunction requiring renal replacement therapy and promoter polymorphism of the erythropoietin gene in cardiac surgery.
21078205 2010 Significant association between polymorphism of the erythropoietin gene promoter and myelodysplastic syndrome.
21067572 2010 Association analysis of nine candidate gene polymorphisms in Indian patients with type 2 diabetic retinopathy.
21042786 2010 The relationship of erythropoietin overexpression with von Hippel-Lindau tumour suppressor gene mutations between hypoxia-inducible factor-1? and -2? in sporadic clear cell renal carcinoma.
21033220 GLUT1 and Bcl-xL in relation to erythropoietin in human colorectal adenocarcinomas.
20979939 2010 Erythropoietin production by distal nephron in normal and familial amyloidotic adult human kidneys.
20966191 2011 Novel serum biomarkers for erythropoietin use in humans: a proteomic approach.
20947680 2011 Effects of intermittent hypoxia on erythropoietin, soluble erythropoietin receptor and ventilation in humans.
20937240 2011 Calcium as a mediator between erythropoietin and protein tyrosine phosphatase 1B.
20937006 2011 Cord blood erythropoietin and interleukin-6 for prediction of intraventricular hemorrhage in the preterm neonate.
20873225 Transduction of human EPO into human bone marrow mesenchymal stromal cells synergistically enhances cell-protective and migratory effects.
20862521 2010 Aqueous humor and serum erythropoietin levels in patients with pseudoexfoliation syndrome and pseudoexfoliative glaucoma.
20804540 2010 Erythropoietin is involved in angiogenesis in human primary melanoma.
20729740 2010 Suboptimal endogenous erythropoietin response in chronic hepatitis C patients during ribavirin and PEG interferon treatment.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20614229 2011 Epo is involved in angiogenesis in human glioma.
20566589 2010 Erythropoietin and vascular endothelial growth factor as risk markers for severe hypoglycaemia in type 1 diabetes.
20395592 2010 Erythropoietin activates mitochondrial biogenesis and couples red cell mass to mitochondrial mass in the heart.
20368990 2010 Roles of coactivators in hypoxic induction of the erythropoietin gene.
20353997 2010 Erythropoietin-induced activation of the JAK2/STAT5, PI3K/Akt, and Ras/ERK pathways promotes malignant cell behavior in a modified breast cancer cell line.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228410 2010 Cardioprotection of exogenous erythropoietin in mice with ligature-induced aortic stenosis: effects on maladaptive cardiac hypertrophy.
20179983 2010 Erythrocytosis caused by erythropoietin-producing thymic carcinoma.
20164027 2009 STAT3 and hypoxia induced proteins--HIF-1alpha, EPO and EPOR in relation with Bax and Bcl-xL in nodal metastases of ductal breast cancers.
20104680 2009 [Effects of intermittent hypoxic exposure on the parameter of erythrocyte and serum hypoxia inducible factor-1 alpha and erythropoietin levels].
20091055 2010 Anti-erythropoietin antibodies followed by endogenous erythropoietin production in a dialysis patient.
20065225 2010 Association between erythropoietin gene polymorphisms and diabetic retinopathy.
20012656 2010 Erythropoietin concentration in serum and cerebrospinal fluid of patients with amyotrophic lateral sclerosis.
19955699 2010 Low erythropoietin plasma levels during exacerbations of COPD.
19932158 2010 Efficient preparation and PEGylation of recombinant human non-glycosylated erythropoietin expressed as inclusion body in E. coli.
19930602 2009 Erythropoietin and its receptors in the brainstem of adults with fatal falciparum malaria.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901910 2010 Erythropoietin-induced upregulation of endothelial nitric oxide synthase but not vascular endothelial growth factor prevents musculocutaneous tissue from ischemic damage.
19890342 2010 Prohepcidin concentrations and erythroid progenitors in cord blood of appropriate versus small for gestational age neonates.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19804771 2010 Expression of HIF-1 alpha, VEGF and EPO in peripheral blood from patients with two cardiac abnormalities associated with hypoxia.
19766721 2010 Antiapoptotic properties of recombinant human erythropoietin protects against tubular cyclosporine toxicity.
19690392 2009 Erythropoietin in patients with acute coronary syndrome and its cardioprotective action after percutaneous coronary intervention.
19619913 2009 Are low erythropoietin and 1,25-dihydroxyvitamin D levels indicative of tubulo-interstitial dysfunction in diabetes without persistent microalbuminuria?
19602911 2009 Elevated erythropoietin in vitreous of patients with rhegmatogenous retinal detachment and proliferative vitreoretinopathy.
19515792 2009 Activation of the erythropoietin receptor in human skeletal muscle.
19463769 2009 Increased plasma EPO and MIP-1 alpha are associated with recruitment of vascular progenitors but not CD34(+) cells in autologous peripheral blood stem cell grafts.
19375648 2009 Low oxygen concentration as a general physiologic regulator of erythropoiesis beyond the EPO-related downstream tuning and a tool for the optimization of red blood cell production ex vivo.
19375647 2009 Interaction between the glucocorticoid and erythropoietin receptors in human erythroid cells.
19339771 2009 Erythropoietin production by a hepatic adenoma in a patient with severe erythrocytosis.
19321698 2009 Sex-dependent regulation of hypoxic ventilation in mice and humans is mediated by erythropoietin.
19269703 2010 Relationship of plasma erythropoietin to long-term outcome in acute coronary syndrome.
19211168 2009 Erythropoietin during hypoglycaemia in type 1 diabetes: relation to basal renin-angiotensin system activity and cognitive function.
19165176 2009 Nonrenal regulation of EPO synthesis.
19136057 2009 Erythropoietin protects retinal pigment epithelial cells from oxidative damage.
19074769 2009 TRPC3 activation by erythropoietin is modulated by TRPC6.
19070519 Differential up-regulation of erythropoietin and its receptor in benign and malignant prostatic tissue.
19042077 2009 Amniotic fluid S100B protein and erythropoietin in pregnancies at risk for fetal hypoxia.
19027957 2009 Non-erythroid activities of erythropoietin: Functional effects on murine dendritic cells.
19014520 2008 Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany.
18928604 2008 [Expression of hematopoietic cytokines EPO, SCF and GM-CSF in bone marrow cells of patients with chronic aplastic anemia].
18922618 2008 Erythropoietin effects on dendritic cells: potential mediators in its function as an immunomodulator?
18787502 2009 Genetic contributions to the development of retinopathy of prematurity.
18722069 2008 Antibody-based enzyme-linked lectin assay (ABELLA) for the sialylated recombinant human erythropoietin present in culture supernatant.
18586515 2008 Erythropoietin promotes axonal growth in a model of neuronal polarization.
18544472 Low serum levels of prohepcidin, but not hepcidin-25, are related to anemia in familial amyloidosis TTR V30M.
18533563 2008 [Study of correlation between obstructive sleep apnea-hypopnea syndrome and erythropoietin].
18479804 2008 Erythropoietin and erythropoietin receptor expression in normal and disturbed pregnancy.
18458324 2008 Promoter polymorphism of the erythropoietin gene in severe diabetic eye and kidney complications.
18414140 2008 Novel red cell indices indicating reduced availability of iron are associated with high erythropoietin concentration and low ph level in the venous cord blood of newborns.
18399174 2007 [Influence of tumor necrosis factor-alpha and interferon-gamma on erythropoietin production and erythropoiesis in cancer patients with anemia].
18356745 2008 Elevated erythropoietin mRNA and protein concentrations in the developing human eye.
18332162 2008 Expression of erythropoietin and its receptor in the human retina: a comparative study of diabetic and nondiabetic subjects.
18278456 2008 Expression of EPO receptor in pancreatic cells and its effect on cell apoptosis.
18276585 2008 TRPC3 is the erythropoietin-regulated calcium channel in human erythroid cells.
18259195 2008 Essential role for Stat5 in the neurotrophic but not in the neuroprotective effect of erythropoietin.
18219110 2008 Increased levels of erythropoietin in nipple aspirate fluid and in ductal cells from breast cancer patients.
18201556 2008 Production of human erythropoietin by chimeric chickens.
18189270 2008 Decreased DMT1 and increased ferroportin 1 expression is the mechanisms of reduced iron retention in macrophages by erythropoietin in rats.
18160550 2008 A pilot study on cord blood levels of erythropoietin and its relationship to periventricular leukomalacia in preterm infants.
18093155 2008 Recombinant human erythropoietin administration protects cortical neurons from traumatic brain injury in rats.
18091448 2007 Aqueous humor erythropoietin levels in patients with primary open-angle glaucoma.
18086112 2008 Erythropoietin promotes hepatic regeneration after extended liver resection in rats.
18074690 2007 Neuroprotective potential of erythropoietin and darbepoetin alfa in an experimental model of sciatic nerve injury. Laboratory investigation.
17984928 2007 Suggestive evidence of erythropoietin level abnormality in patients with sporadic and familial cases of the restless legs syndrome.
17952604 2007 Protective effect of erythropoietin against ketamine-induced apoptosis in cultured rat cortical neurons: involvement of PI3K/Akt and GSK-3 beta pathway.
17893875 2008 Erythropoietin treatment of human ovarian cancer cells results in enhanced signaling and a paclitaxel-resistant phenotype.
17893874 2008 Characterization of erythropoietin receptor and erythropoietin expression and function in human ovarian cancer cells.
17888545 2009 Is erythropoietin gene a modifier factor in amyotrophic lateral sclerosis?
17873970 Erythropoietin protects the intestine against ischemia/ reperfusion injury in rats.
17713555 2007 Human telomerase is regulated by erythropoietin and transforming growth factor-beta in human erythroid progenitor cells.
17652365 2007 Acute and chronic exposure to hypoxia alters ventilatory pattern but not minute ventilation of mice overexpressing erythropoietin.
17647284 2007 Expression of erythropoietin and its receptor in neuroblastomas.
17645631 2007 Erythropoietin enhances angiogenesis in an experimental cyclosporine A-induced nephrotoxicity model in the rat.
17636183 2007 Does erythropoietin have a dark side? Epo signaling and cancer cells.
17615151 2007 Erythropoietin inhibits basal and stimulated corticotropin-releasing hormone release from the rat hypothalamus via a nontranscriptional mechanism.
17597020 2007 STAT3, HIF-1alpha, EPO and EPOR - signaling proteins in human primary ductal breast cancers.
17577097 2007 Darbepoetin alfa protects the rat heart against infarction: dose-response, phase of action, and mechanisms.
17540710 2007 Human hair follicles are an extrarenal source and a nonhematopoietic target of erythropoietin.
17481772 2007 Novel role of erythropoietin in proliferative diabetic retinopathy.
17467346 2007 Erythropoietin regulations in humans under different environmental and experimental conditions.
17442163 2007 [Hydrogen peroxide induces expression and transcription of erythropoietin in the human retinal pigment epithelium cells].
17395782 2007 Enhanced erythro-phagocytosis in polycythemic mice overexpressing erythropoietin.
17389738 2007 Erythropoietin decreases renal fibrosis in mice with ureteral obstruction: role of inhibiting TGF-beta-induced epithelial-to-mesenchymal transition.
17372034 2007 Essential role of endothelial nitric oxide synthase in vascular effects of erythropoietin.
17360900 2007 Erythropoietin enhances hippocampal response during memory retrieval in humans.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17145806 2006 Expression of erythropoietin and erythropoietin receptor in cervical cancer and relationship to survival, hypoxia, and apoptosis.
17081058 2006 Mass spectrometry-based glycoproteomic approach involving lysine derivatization for structural characterization of recombinant human erythropoietin.
17045782 2007 A "classical" homodimeric erythropoietin receptor is essential for the antiapoptotic effects of erythropoietin on differentiated neuroblastoma SH-SY5Y and pheochromocytoma PC-12 cells.
16936148 2006 Erythropoietin is expressed in the human retina and it is highly elevated in the vitreous fluid of patients with diabetic macular edema.
16909043 2006 Induction of signalling in non-erythroid cells by pharmacological levels of erythropoietin.
16883594 2006 2-Oxoglutarate downregulates expression of vascular endothelial growth factor and erythropoietin through decreasing hypoxia-inducible factor-1alpha and inhibits angiogenesis.
16838166 2007 Inverse relationship between serum erythropoietin and blood lead concentrations in Kathmandu tricycle taxi drivers.
16699298 2006 Erythropoietin in thyroid cancer.
16684536 2006 Erythropoietin production: Molecular mechanisms of the antagonistic actions of cyclic adenosine monophosphate and interleukin-1.
16645141 2006 Erythropoietin-mobilized endothelial progenitors enhance reendothelialization via Akt-endothelial nitric oxide synthase activation and prevent neointimal hyperplasia.
16627979 2006 Coexpression of erythopoietin and erythopoietin receptor in sporadic clear cell renal cell carcinoma.
16497104 2006 Hepcidin mRNA levels in mouse liver respond to inhibition of erythropoiesis.
16475009 2006 Dynamic control of oligosaccharide modification in the mammary gland: linking recombinant human erythropoietin functional analysis of transgenic mouse milk-derived hEPO.
16467207 2006 Wilms tumor suppressor, Wt1, is a transcriptional activator of the erythropoietin gene.
16332412 2006 Recombinant human erythropoietin prevents ischemia-induced apoptosis and necrosis in explant cultures of the rat organ of Corti.
16286456 2006 Cellular trafficking and degradation of erythropoietin and novel erythropoiesis stimulating protein (NESP).
16278379 2005 Relation of erythropoietin and erythropoietin receptor expression to hypoxia and anemia in head and neck squamous cell carcinoma.
16229477 2005 Erythropoietin unfolding: thermodynamics and its correlation with structural features.
16123502 2005 Erythropoietin is highly elevated in vitreous fluid of patients with proliferative diabetic retinopathy.
15993382 2005 Erythropoietin attenuated high glucose-induced apoptosis in cultured human aortic endothelial cells.
15988318 2005 Association between nucleated red blood cells in blood and the levels of erythropoietin, interleukin 3, interleukin 6, and interleukin 12p70.
15967106 2005 Erythropoietin signaling promotes invasiveness of human head and neck squamous cell carcinoma.
15856028 2005 Erythropoietin-mediated activation of JAK-STAT signaling contributes to cellular invasion in head and neck squamous cell carcinoma.
15795697 2005 A comparative study of the role of erythropoietin in the pathogenesis of deficient erythropoiesis in idiopathic pulmonary fibrosis as opposed to chronic obstructive pulmonary disease.
15777837 2005 The distinct erythropoietin functions that promote cell survival and proliferation are affected by aluminum exposure through mechanisms involving erythropoietin receptor.
15769989 2005 Differential expression of erythropoietin and its receptor in von hippel-lindau-associated and multiple endocrine neoplasia type 2-associated pheochromocytomas.
15743794 2005 Functional erythropoietin autocrine loop in melanoma.
15728783 2005 Erythropoietin increases asymmetric dimethylarginine in endothelial cells: role of dimethylarginine dimethylaminohydrolase.
15718359 2005 Association between erythropoietin in cord blood of twins and size at birth: does it relate to gestational factors or to factors during labor or delivery?
15709172 2005 Coexpression of erythropoietin and erythropoietin receptor in von Hippel-Lindau disease-associated renal cysts and renal cell carcinoma.
15709164 2005 Expression of erythropoietin and erythropoietin receptor in non-small cell lung carcinomas.
15705187 2005 Vascular endothelial growth factor and its soluble receptor, Flt-1, are not correlated to erythropoietin in diabetics with normal or reduced renal function.
15671524 2005 Erythropoietin and erythropoietin receptor expression in head and neck cancer: relationship to tumor hypoxia.
15627795 2004 Does angiotensin II modulate erythropoietin production in HepG2 cells?
15590452 2004 A single dose of erythropoietin attenuates lipid peroxidation in experimental liver ischemia-reperfusion injury in the rat fetus.
15502930 2004 High amniotic fluid erythropoietin levels are associated with an increased frequency of fetal and neonatal morbidity in type 1 diabetic pregnancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467711 2005 Erythropoietin and erythropoietin receptor expression in human prostate cancer.
15389732 2005 Brain and cancer: the protective role of erythropoietin.
15363820 2004 Erythropoietin and obstructive sleep apnea.
15347669 2004 Roles of Brahma and Brahma/SWI2-related gene 1 in hypoxic induction of the erythropoietin gene.
15339684 2004 Analysis of human reticulocyte genes reveals altered erythropoiesis: potential use to detect recombinant human erythropoietin doping.
15257091 2004 Recombinant human erythropoietin stimulates angiogenesis and healing of ischemic skin wounds.
15240563 2004 Differentiating the functional role of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha (EPAS-1) by the use of RNA interference: erythropoietin is a HIF-2alpha target gene in Hep3B and Kelly cells.
15210945 2004 Acute neuroprotective synergy of erythropoietin and insulin-like growth factor I.
15205261 2004 Erythropoietin and hypoxia stimulate erythropoietin receptor and nitric oxide production by endothelial cells.
15183662 2004 Recombinant erythropoietin as a neuroprotective treatment: in vitro and in vivo models.
15160341 2004 Prognostic significance of erythropoietin expression in human endometrial carcinoma.
15142852 2004 Oxygen-dependent and tissue-specific regulation of erythropoietin gene expression.
15112358 2004 Plasma erythropoietin levels in anaemic and non-anaemic patients with chronic liver diseases.
15084469 2004 Disruption of ferroportin 1 regulation causes dynamic alterations in iron homeostasis and erythropoiesis in polycythaemia mice.
15053948 2004 Erythropoietin and the nervous system.
15019812 2004 Detection of erythropoietin in human seminal plasma.
14990112 2004 [Relationship between tumor necrosis factor alpha, interleukin-6 and erythropoietin in children's with chronic anemia and influence of recombinant human tumor necrosis factor alpha on erythropoietin gene expression].
14755373 2004 Erythropoietin-deficient anemia associated with autoimmune polyglandular syndrome type I.
14747752 2004 Mechanisms of erythropoietin-induced brain protection in neonatal hypoxia-ischemia rat model.
14724429 2004 Adenoviral gene transfer of erythropoietin confers cytoprotection to isolated pancreatic islets.
14718663 2004 Erythropoietin both protects from and reverses experimental diabetic neuropathy.
14704034 2003 The signaling pathways of erythropoietin and interferon-gamma differ in preventing the apoptosis of mature erythroid progenitor cells.
14671634 2004 Recombinant human erythropoietin induces intussusceptive microvascular growth in vivo.
14584755 2003 Erythropoietin and the erythropoietin receptor are expressed by papillary thyroid carcinoma from children and adolescents. Expression of erythropoietin receptor might be a favorable prognostic indicator.
14583613 2004 Hepatic erythropoietin gene regulation by GATA-4.
14569084 2003 Inhibition of erythrocyte cation channels by erythropoietin.
12975460 2003 Erythropoietin selectively attenuates cytokine production and inflammation in cerebral ischemia by targeting neuronal apoptosis.
12960323 2003 The WD motif-containing protein RACK-1 functions as a scaffold protein within the type I IFN receptor-signaling complex.
12937140 2003 A novel role for erythropoietin during fibrin-induced wound-healing response.
12853948 2003 The DNA sequence of human chromosome 7.
12829027 2003 Stem cell factor enhances erythropoietin-mediated transactivation of signal transducer and activator of transcription 5 (STAT5) via the PKA/CREB pathway.
12801298 2003 Haemoglobin during pregnancy: relationship to erythropoietin and haematinic status.
12759237 2003 Hypoxia-inducible erythropoietin signaling in squamous dysplasia and squamous cell carcinoma of the uterine cervix and its potential role in cervical carcinogenesis and tumor progression.
12734640 2003 Suppression of erythropoietin gene expression by cadmium depends on inhibition of HIF-1, not stimulation of GATA-2.
12525458 2003 Expression of erythropoietin and erythropoietin receptor in peritoneal endometriosis.
12482504 2002 NF-kappaB plays a key role in hypoxia-inducible factor-1-regulated erythropoietin gene expression.
12477950 2002 Erythropoietin--an endogenous retinal survival factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12476588 2002 [Possible role of soluble erythropoietin receptors in renal anemia].
12463751 2002 Glycosylation of erythropoietin affects receptor binding kinetics: role of electrostatic interactions.
12419827 2002 Erythropoietin is involved in growth and angiogenesis in malignant tumours of female reproductive organs.
12381912 2002 Unexpected renal actions of erythropoietin.
12362243 2002 Erythropoietin triggers a signaling pathway in endothelial cells and increases the thrombogenicity of their extracellular matrices in vitro.
12239177 2002 Hypoxia-inducible erythropoietin gene expression in human neuroblastoma cells.
12212844 2002 The use of the uromodulin promoter to target production of recombinant proteins into urine of transgenic animals.
12207089 2002 From erythropoietin to oxygen: hypoxia-inducible factor hydroxylases and the hypoxia signal pathway.
12192960 2002 Erythropoietin in human milk: physiology and role in infant health.
12187026 2002 Evaluation of tumor necrosis factor-alpha and erythropoietin serum levels in B-cell chronic lymphocytic leukemia patients with anemia.
12171772 2002 Circulating thrombopoietin in clonal versus reactive thrombocytosis.
12130665 2002 Erythropoietin administration protects retinal neurons from acute ischemia-reperfusion injury.
12091337 2002 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
12082184 2002 Recombinant human erythropoietin counteracts secondary injury and markedly enhances neurological recovery from experimental spinal cord trauma.
12068288 2002 HIF-1-induced erythropoietin in the hypoxic retina protects against light-induced retinal degeneration.
11994541 2002 Erythropoietin and erythropoietin receptor expression in human endometrium throughout the menstrual cycle.
11919332 2002 Erythropoietin stimulates vasculogenesis in neonatal rat mesenteric microvascular endothelial cells.
11865075 2002 Erythropoietin, tumours and the von Hippel-Lindau gene: towards identification of mechanisms and dysfunction of oxygen sensing.
11739166 2001 Sugar profiling proves that human serum erythropoietin differs from recombinant human erythropoietin.
11493922 2001 Erythropoietin-mediated neuroprotection involves cross-talk between Jak2 and NF-kappaB signalling cascades.
11305874 2001 Erythropoietin and erythropoietin receptors in human CNS neurons, astrocytes, microglia, and oligodendrocytes grown in culture.
11259643 2001 Erythropoietin prevents neuronal apoptosis after cerebral ischemia and metabolic stress.
11239002 2001 Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5.
10984541 2000 Erythropoietin crosses the blood-brain barrier to protect against experimental brain injury.
10318834 1999 Shared and unique determinants of the erythropoietin (EPO) receptor are important for binding EPO and EPO mimetic peptide.
9847074 1998 Toward a complete human genome sequence.
9808045 1998 An antagonist peptide-EPO receptor complex suggests that receptor dimerization is not sufficient for activation.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
9783743 1998 NMR structure of human erythropoietin and a comparison with its receptor bound conformation.
9774108 1998 Efficiency of signalling through cytokine receptors depends critically on receptor orientation.
9722506 1998 Insulin-like growth factor-I augments erythropoietin-induced proliferation through enhanced tyrosine phosphorylation of STAT5.
9539790 1998 In vivo evidence that erythropoietin protects neurons from ischemic damage.
8396923 1993 Gene expression of mutant erythropoietin in hepatocellular carcinoma.
6698989 1984 Isolation of human erythropoietin with monoclonal antibodies.
3949763 1986 Structural characterization of human erythropoietin.
3865178 1985 Cloning and expression of the human erythropoietin gene.
3838366 1985 Isolation and characterization of genomic and cDNA clones of human erythropoietin.
3462737 1986 Chromosomal assignment of the human erythropoietin gene and its DNA polymorphism.
3462706 1986 Human erythropoietin gene: high level expression in stably transfected mammalian cells and chromosome localization.
3346214 1988 Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells.
3219367 1988 Site-specific glycosylation of human recombinant erythropoietin: analysis of glycopeptides or peptides at each glycosylation site by fast atom bombardment mass spectrometry.
2875851 1986 Regional assignment of the erythropoietin gene to human chromosome region 7pter----q22.
2849206 1988 Regulation of the erythropoietin gene: evidence that the oxygen sensor is a heme protein.
1820196 1991 Structures and functional roles of the sugar chains of human erythropoietins.