Property Summary

NCBI Gene PubMed Count 77
PubMed Score 282.51
PubTator Score 120.07

Knowledge Summary

Patent

No data available

 GO Component (1)

Gene RIF (49)

AA Sequence

MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAARHALPLWGGGATRRGRRPAG      1 - 70
AAGGGVAARAGALGAARCRPPEAGRHRGGRRGPGPAGAGPVARGGGAGGRGGGAGRGGAGPRGHVLVQVP     71 - 140
EAGAGRRALLGRYCQQTPAPGAERELRPAPPTGASASGRPRRPRRRASRAFCPRPCALPGRPGLTLLCRP    141 - 210
RCRRQPRLRLPTDSLDPYSAPGRLPAHSVACPSDLVSAHPVLSFFPTAPASRASALRLPPGAPFALRVPL    211 - 280
DLRVPPFAGPLAARPRAADGFNSPTPPWLGFVSSFSCSNSLKKTQNDPTNETSVFANPRQQCAT          281 - 344
//

Text Mined References (77)

PMID Year Title