Property Summary

NCBI Gene PubMed Count 77
PubMed Score 282.51
PubTator Score 120.07

Knowledge Summary

Patent

No data available

Synonym

Accession B3EWF7
Symbols EPM2
MELF

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Gene RIF (49)

AA Sequence

MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAARHALPLWGGGATRRGRRPAG      1 - 70
AAGGGVAARAGALGAARCRPPEAGRHRGGRRGPGPAGAGPVARGGGAGGRGGGAGRGGAGPRGHVLVQVP     71 - 140
EAGAGRRALLGRYCQQTPAPGAERELRPAPPTGASASGRPRRPRRRASRAFCPRPCALPGRPGLTLLCRP    141 - 210
RCRRQPRLRLPTDSLDPYSAPGRLPAHSVACPSDLVSAHPVLSFFPTAPASRASALRLPPGAPFALRVPL    211 - 280
DLRVPPFAGPLAARPRAADGFNSPTPPWLGFVSSFSCSNSLKKTQNDPTNETSVFANPRQQCAT          281 - 344
//

Text Mined References (77)

PMID Year Title