Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.27
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.900 1.2e-03
ependymoma -3.100 1.0e-03
oligodendroglioma -2.400 6.5e-03
glioblastoma -2.600 3.4e-04
medulloblastoma -3.300 2.5e-06
cystic fibrosis 1.553 8.7e-05
atypical teratoid / rhabdoid tumor -2.800 2.7e-06
medulloblastoma, large-cell -3.500 1.8e-03
primitive neuroectodermal tumor -3.100 3.9e-04
active ulcerative colitis 1.128 4.1e-02
pancreatic cancer 1.300 6.5e-06
adult high grade glioma -2.000 2.9e-02
ovarian cancer 2.500 2.7e-05
psoriasis -1.100 2.4e-19

Synonym

Accession Q8IUS5 Q8NCC6
Symbols EH4
ABHD7
EPHXRP

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
22798687 The identification of two human epoxide hydrolases: EH3 and EH4.
20723587 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARLRDCLPRLMLTLRSLLFWSLVYCYCGLCASIHLLKLLWSLGKGPAQTFRRPAREHPPACLSDPSLGT      1 - 70
HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEYRVVALDLRGYGETDAPIHRQ     71 - 140
NYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQ    141 - 210
LLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINH    211 - 280
YRNIFSCLPLKHHMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLI    281 - 350
WTFLKEETRKKD                                                              351 - 362
//

Text Mined References (7)

PMID Year Title
22798687 2012 EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.