Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.27
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 1.128 4.1e-02
adult high grade glioma -2.000 2.9e-02
astrocytic glioma -2.900 1.2e-03
atypical teratoid / rhabdoid tumor -2.800 2.7e-06
cystic fibrosis 1.553 8.7e-05
ependymoma -3.100 1.0e-03
glioblastoma -1.500 2.5e-03
group 3 medulloblastoma -2.800 2.8e-02
medulloblastoma, large-cell -3.500 1.8e-03
oligodendroglioma -2.400 6.5e-03
ovarian cancer 2.500 2.7e-05
pancreatic cancer 1.300 6.5e-06
primitive neuroectodermal tumor -3.100 3.9e-04
psoriasis -1.100 2.4e-19

Synonym

Accession Q8IUS5 Q8NCC6
Symbols EH4
ABHD7
EPHXRP

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MARLRDCLPRLMLTLRSLLFWSLVYCYCGLCASIHLLKLLWSLGKGPAQTFRRPAREHPPACLSDPSLGT      1 - 70
HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEYRVVALDLRGYGETDAPIHRQ     71 - 140
NYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQ    141 - 210
LLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINH    211 - 280
YRNIFSCLPLKHHMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLI    281 - 350
WTFLKEETRKKD                                                              351 - 362
//

Text Mined References (7)

PMID Year Title