Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.79
PubTator Score 10.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Stomach Neoplasms 300 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -2.700 2.0e-02
lung adenocarcinoma 1.254 4.7e-05
nasopharyngeal carcinoma -1.100 2.2e-02
non-small cell lung cancer 1.632 6.3e-09
psoriasis 1.400 2.4e-06

Gene RIF (4)

AA Sequence

MPELVVTALLAPSRLSLKLLRAFMWSLVFSVALVAAAVYGCIALTHVLCRPRRGCCGRRRSASPACLSDP      1 - 70
SLGEHGFLNLKSSGLRLHYVSAGRGNGPLMLFLHGFPENWFSWRYQLREFQSRFHVVAVDLRGYGPSDAP     71 - 140
RDVDCYTIDLLLVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMSVYQDYSLH    141 - 210
HISQFFRSHYMFLFQLPWLPEKLLSMSDFQILKTTLTHRKTGIPCLTPSELEAFLYNFSQPGGLTGPLNY    211 - 280
YRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQY    281 - 350
MWAFLQDLLD                                                                351 - 360
//

Text Mined References (9)

PMID Year Title