Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.73
PubTator Score 10.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -2.700 2.0e-02
psoriasis 1.700 7.3e-04
non-small cell lung cancer 1.632 6.3e-09
nasopharyngeal carcinoma -1.100 2.2e-02
lung adenocarcinoma 1.254 4.7e-05

Gene RIF (4)

PMID Text
24718283 These results validate the association between promoter hypermethylation of ABHD9 and HOXD3 and prostate cancer recurrence
22798687 The identification of two human epoxide hydrolases: EH3 and EH4.
20723587 Observational study of gene-disease association. (HuGE Navigator)
17437806 methylation of the ABHD9 is significantly associated with prostate cancer prognosis.

AA Sequence

MPELVVTALLAPSRLSLKLLRAFMWSLVFSVALVAAAVYGCIALTHVLCRPRRGCCGRRRSASPACLSDP      1 - 70
SLGEHGFLNLKSSGLRLHYVSAGRGNGPLMLFLHGFPENWFSWRYQLREFQSRFHVVAVDLRGYGPSDAP     71 - 140
RDVDCYTIDLLLVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMSVYQDYSLH    141 - 210
HISQFFRSHYMFLFQLPWLPEKLLSMSDFQILKTTLTHRKTGIPCLTPSELEAFLYNFSQPGGLTGPLNY    211 - 280
YRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQY    281 - 350
MWAFLQDLLD                                                                351 - 360
//

Text Mined References (9)

PMID Year Title
24718283 2014 Validation study of genes with hypermethylated promoter regions associated with prostate cancer recurrence.
22798687 2012 EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
17437806 2007 Discovery and validation of 3 novel DNA methylation markers of prostate cancer prognosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.