Property Summary

Ligand Count 1,376
NCBI Gene PubMed Count 118
PubMed Score 349.09
PubTator Score 390.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Dental caries 164 0.0 2.1

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.649 1.5e-04
atypical teratoid / rhabdoid tumor 1.300 2.4e-03
colon cancer -1.200 8.6e-04
cutaneous lupus erythematosus -1.100 5.9e-03
ependymoma 1.400 3.6e-06
inflammatory breast cancer -1.800 1.9e-02
interstitial cystitis -1.100 6.1e-04
intraductal papillary-mucinous carcinoma... -1.500 9.0e-03
intraductal papillary-mucinous neoplasm ... -1.700 1.8e-02
lung carcinoma 2.400 2.4e-33
osteosarcoma -1.186 8.7e-03
ovarian cancer -1.900 3.2e-09
pancreatic cancer -1.200 3.3e-04
pancreatic ductal adenocarcinoma liver m... -1.618 6.5e-03
psoriasis -1.500 3.5e-04
sarcoidosis -1.100 5.1e-03
tuberculosis 1.600 5.2e-05
ulcerative colitis -1.700 1.8e-05

PDB (98)

Gene RIF (95)

AA Sequence

MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN      1 - 70
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM     71 - 140
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL    141 - 210
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA    211 - 280
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE    281 - 350
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH    351 - 420
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM    421 - 490
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM         491 - 555
//

Text Mined References (128)

PMID Year Title