Property Summary

NCBI Gene PubMed Count 110
PubMed Score 305.09
PubTator Score 390.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 5.9e-03
psoriasis -1.500 3.5e-04
osteosarcoma -1.186 8.7e-03
posterior fossa group B ependymoma 1.900 2.7e-08
atypical teratoid / rhabdoid tumor 1.300 2.4e-03
adrenocortical carcinoma -1.649 1.5e-04
tuberculosis 1.600 5.2e-05
pancreatic ductal adenocarcinoma liver m... -1.618 6.5e-03
intraductal papillary-mucinous carcinoma... -1.500 9.0e-03
intraductal papillary-mucinous neoplasm ... -1.700 1.8e-02
colon cancer -1.200 8.6e-04
pancreatic cancer -1.600 9.6e-03
interstitial cystitis -1.100 6.1e-04
inflammatory breast cancer -1.800 1.9e-02
lung carcinoma 2.400 2.4e-33
ulcerative colitis -1.700 1.8e-05
ovarian cancer -1.900 3.2e-09
sarcoidosis -1.100 5.1e-03

Synonym

Accession P34913 B2Z3B1 B3KTU8 B3KUA0 G3V134 J3KPH7 Q16764 Q9HBJ1 Q9HBJ2
Symbols CEH
SEH

Gene

PANTHER Protein Class (3)

PDB

1S8O   1VJ5   1ZD2   1ZD3   1ZD4   1ZD5   3ANS   3ANT   3I1Y   3I28   3KOO   3OTQ   3PDC   3WK4   3WK5   3WK6   3WK7   3WK8   3WK9   3WKA   3WKB   3WKC   3WKD   3WKE   4C4X   4C4Y   4C4Z   4HAI   4J03   4JNC   4OCZ   4OD0   4X6X   4X6Y   4Y2J   4Y2P   4Y2Q   4Y2R   4Y2S   4Y2T   4Y2U   4Y2V   4Y2X   4Y2Y   5AHX   5AI0   5AI4   5AI5   5AI6   5AI8   5AI9   5AIA   5AIB   5AIC   5AK3   5AK4   5AK5   5AK6   5AKE   5AKG   5AKH   5AKI   5AKJ   5AKK   5AKL   5AKX   5AKY   5AKZ   5ALD   5ALE   5ALF   5ALG   5ALH   5ALI   5ALJ   5ALK   5ALL   5ALM   5ALN   5ALO   5ALP   5ALQ   5ALR   5ALS   5ALT   5ALU   5ALV   5ALW   5ALX   5ALY   5ALZ   5AM0   5AM1   5AM2   5AM3   5AM4   5AM5   5FP0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
707 screening 310 / 0 / 90339 Novel sEH inhibitors for the therapeutic treatment of hypertension and inflammation
717 screening 38 / 0 / 90611 Novel sEH activators for the therapeutic treatment of hypertension and inflammation
1026 confirmatory 44 / 0 / 257 sEH_DR_Inh_Infinite200_Fluorescence_01072008

Gene RIF (88)

PMID Text
26976569 Increased levels of soluble epoxide hydrolase in the brain of depressed patients
26453326 Suggest role for Ephx2 in vascular smooth muscle phenotypic modulation and migration in the development of atherosclerosis.
26341485 Within the EPHX2 promoter -56/+32, five Sp1-binding sites were identified, and the mutation of each of these sites showed that the first one (SP1_1) was important in both suppression by Sp1 and activation by AP2alpha.
26230946 carriers of rs1042032 GG genotype had lower estimated glomerular filtration rate and higher serum creatinine values 1 year after grafting compared to patients carrying wildtype A-allele; this GG genotype also associated to increased risk of acute rejection; results suggest genetic variability in EPHX2 may have an impact on outcome of deceased-donor renal transplantation
25966114 Essential hypertension is associated with the rs751141 G/A allele gene polymorphism in EPHX2 in Han subjects but not in Kazakh and Uygur subjects.
25947240 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke.
25839935 Results show that CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction confers a significantly higher risk for ischemic stroke.
25659109 Potent natural soluble epoxide hydrolase inhibitors from Pentadiplandra brazzeana baillon: synthesis, quantification, and measurement of biological activities in vitro and in vivo.
25388680 Patients with CYP2C8*2C and EPHX2 404del variants had worse long-term outcomes while those with EPHX2 287Gln, CYP2J2*7, and CYP2C9 g.816G variants had favorable outcomes.
25216066 Genetic polymorphisms of soluble EH are associated with neurological and vital outcomes after aneurysmal subarachnoid hemorrhage.
25173047 A genetic variant that results in decreased soluble epoxide hydrolase activity is associated with increased insulin sensitivity.
23999524 Findings suggest a novel association of gene variants within EPHX2 to susceptibility to anorexia nervosa and provide a foundation for future study of this important yet poorly understood condition
23711456 Presence of single nucleotide polymorphism rs751141 of EPHX2 is associated with significantly increased risk of atrial fibrillation recurrence following catheter ablation.
23576437 sEH is a physiological modulator of ER stress and a potential target for mitigating complications associated with obesity
23362272 Soluble epoxide hydrolase dimerization is required for hydrolase activity
23160182 the importance of sEH in MCP-1-regulated monocyte chemotaxis
23152298 Upregulation of sEH in proximal tubular cells in chronic proteinuric kidney diseases may mediate proteinuria-induced renal damage.
23011468 Evidence suggests that modulation of plasma levels of epoxyeicosatrienoic acid (EET) (for example, down-regulation of EET in patients with renovascular disease-associated hypertension) is due, in part, to up-regulation of EPHX2. [REVIEW]
22986331 Study analyzed the association between four SNPs in the EPHX1 and EPHX2 and the risk of oligozoospermia and asthenospermia; rs1051740, rs2234922 and rs751141 were not associated with oligozoospermia and asthenospermia and rs1042064 was a protective factor in idiopathic male infertility.
22739108 investigation of role of cytoplasmic Ephx2 in diabetic nephropathy by gene disruption techniques: Ephx2 gene inhibition (or added epoxyeicosatrienoic acids) protects renal proximal tubular cell line from tumor necrosis factor-alpha-induced apoptosis.
22387545 These findings also underline possible cellular mechanisms by which both activities of sEH (EH and phosphatase) may have complementary or opposite roles.
22354938 ATF6 activation and DNA demethylation may coordinately contribute to Hcy-induced sEH expression and endothelial activation.
22336502 The essential hypertension in Kazaks in Xinjiang is not associated with rs751141G/A gene polymorphism, but is associated with rs751141G/A allele gene polymorphism of EPHX2.
21704394 sEH is one of the etiological factors of cardiovascular diseases, and plays an important role in the progression of myocardium ischemia.
21642892 This case-control study as well as meta-analysis suggested no association between CYP2J2 G-50T and EPHX2 R287Q and the risk of developing coronary artery disease .
21429967 In patients with IgA nephropathy, some single nucleotide polymorphisms of EPHX2 were associated with more rapid disease progression.
21281786 The PLA2G7, HPGD, EPHX2, and CYP4F8 genes are highly expressed in prostate cancer.
21098312 Genetic variation in epoxide hydrolase 2 is associated with forearm vasodilator responses in a bradykinin receptor- and endothelium-independent manner, suggesting an important role for soluble epoxide hydrolase in regulating vascular function in humans.
20888937 SP-1 is involved in the decrease in the transcription of sEH as a result of DNA methylation in HepG2 cells, which might contribute to epigenetic mechanism-induced carcinogenesis in hepatocytes.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20065888 The functional K55R polymorphism of the EPHX2 gene confers a higher risk of hypertension prevalence and increases the risk of incident ischemic stroke in male homozygotes.
20065888 Observational study of gene-disease association. (HuGE Navigator)
19940276 Results show that no relationship exists between EPHX2 and risk of ischemic stroke, myocardial infarction, and ischemic heart disease.
19940276 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19814804 EPHX2 K55R polymorphism is not associated with restenosis after PCI, with incidence of coronary heart disease, or with an increased risk of hypertension.
19814804 Observational study of gene-disease association. (HuGE Navigator)
19704161 Data indicate that the activity of soluble epoxide hydrolase can be regulated by the tyrosine nitration of the protein.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18784359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18775727 Results describe the catalytic mechanism of dephosphorylation by soluble epoxide hydrolase, using phosphatase active-site mutants created by site-directed mutagenesis.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18589104 Presence of a variant allele in EPHXw is associated with a protective role for kidney allograft function.
18589104 Observational study of gene-disease association. (HuGE Navigator)
18537101 Results provide additional evidence that EPHX2 contributes to the risk of subclinical cardiovascular disease.
18537101 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18323494 Three EPHX2 single nucleotide polymorphisms showed associations with an increased risk for ischemic stroke
18323494 Observational study of gene-disease association. (HuGE Navigator)
18319271 Our results indicate differential localization of sEH in the human brain, thus suggestive of an essential role for this enzyme in the central nervous system.
18216721 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18078836 The minimal promoter was identified as a GC-rich region between nts -374 and +28 with respect to the putative transcriptional start site.
17919073 Our results demonstrated significant association with exon 3 variant genotypes of the mEH alone or in combination with tobacco users (p < 0.005), whereas in exon 4 genotypes, no association was observed.
17498780 Observational study of gene-disease association. (HuGE Navigator)
17495027 AP-1 activation is involved in the transcriptional up-regulation of sEH by angiotensin II (Ang II) in endothelial cells, which may contribute to Ang II-induced hypertension
17460077 human EPHX2 mutations may in part explain the genetic variability in sensitivity to ischemic brain injury and stroke outcome
16957870 comprehensive analysis of the distribution of sEH, CYP2C8, 2C9 and 2J2 in human neoplastic tissues using tissue micro-arrays
16595607 Observational study of gene-disease association. (HuGE Navigator)
16595607 EPHX2 as a potential cardiovascular disease-susceptibility gene.
16545818 Observational study of gene-disease association. (HuGE Navigator)
16545818 EPHX2 has an emerging role as a risk factor for atherosclerosis, whose effects are influenced by smoking
16414022 Consistent with the finding of isoprenoid phosphates as substrates for sEH, we identified isoprenoid-derived N-terminal inhibitors with IC50 values ranging from 0.84 (+/-0.9) to 55.1 (+/-30.7) microM.
16202848 Soluble epoxide epoxygenase-related SNP is not associated with increased risk of hypertension in the African American population.
16115816 Observational study of gene-disease association. (HuGE Navigator)
16115816 Multiple variants exist within or near the EPHX2 gene, with greatly contrasting relationships to ischemic stroke incidence; some associated with a higher incidence and others with a lower incidence.
15845398 Observational study of gene-disease association. (HuGE Navigator)
15845398 Close association of soluble epoxide hydrolase gene G860A (Arg287Gln) polymorphism with insulin resistance in type 2 diabetic patients.
14732757 Observational study of gene-disease association. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
11692079 Observational study of gene-disease association. (HuGE Navigator)
11692079 Common polymorphisms within EPHX2 do not appear to be important risk factors for Parkinson's disease.

AA Sequence

MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN      1 - 70
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM     71 - 140
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL    141 - 210
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA    211 - 280
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE    281 - 350
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH    351 - 420
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM    421 - 490
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM         491 - 555
//

Text Mined References (120)

PMID Year Title
26976569 2016 Gene deficiency and pharmacological inhibition of soluble epoxide hydrolase confers resilience to repeated social defeat stress.
26453326 2015 Soluble epoxide hydrolase is involved in the development of atherosclerosis and arterial neointima formation by regulating smooth muscle cell migration.
26341485 2015 Down-regulation of EPHX2 gene transcription by Sp1 under high-glucose conditions.
26230946 2015 A 3'-UTR Polymorphism in Soluble Epoxide Hydrolase Gene Is Associated with Acute Rejection in Renal Transplant Recipients.
25966114 2015 Relationship between EPHX2 gene polymorphisms and essential hypertension in Uygur, Kazakh, and Han.
25947240 2015 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke in Chinese Populations.
25839935 2015 CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction increases susceptibility to ischemic stroke.
25659109 2015 Potent natural soluble epoxide hydrolase inhibitors from Pentadiplandra brazzeana baillon: synthesis, quantification, and measurement of biological activities in vitro and in vivo.
25388680 2015 Genetic markers in the EET metabolic pathway are associated with outcomes in patients with aneurysmal subarachnoid hemorrhage.
25216066 2014 Genetic variation in soluble epoxide hydrolase: association with outcome after aneurysmal subarachnoid hemorrhage.
25173047 2014 Arg287Gln variant of EPHX2 and epoxyeicosatrienoic acids are associated with insulin sensitivity in humans.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999524 2014 Evidence for the role of EPHX2 gene variants in anorexia nervosa.
23711456 2013 Variations in the human soluble epoxide hydrolase gene and recurrence of atrial fibrillation after catheter ablation.
23576437 2013 Soluble epoxide hydrolase deficiency or inhibition attenuates diet-induced endoplasmic reticulum stress in liver and adipose tissue.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362272 2013 Soluble epoxide hydrolase dimerization is required for hydrolase activity.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23160182 2013 Metabolic products of soluble epoxide hydrolase are essential for monocyte chemotaxis to MCP-1 in vitro and in vivo.
23152298 2013 Upregulation of soluble epoxide hydrolase in proximal tubular cells mediated proteinuria-induced renal damage.
23011468 2013 Epoxyeicosatrienoic acid pathway in human health and diseases.
22986331 2012 Genetic variants in epoxide hydrolases modify the risk of oligozoospermia and asthenospermia in Han-Chinese population.
22739108 2012 Genetic disruption of soluble epoxide hydrolase is protective against streptozotocin-induced diabetic nephropathy.
22387545 2012 Role of soluble epoxide hydrolase phosphatase activity in the metabolism of lysophosphatidic acids.
22354938 2012 Homocysteine upregulates soluble epoxide hydrolase in vascular endothelium in vitro and in vivo.
22336502 2011 [Relationship between EPHX2 gene polymorphism and essential hypertension in Kazaks and Hans in Xinjiang].
21704394 2012 Soluble epoxide hydrolase and ischemic cardiomyopathy.
21642892 2011 Association between polymorphisms of CYP2J2 and EPHX2 genes and risk of coronary artery disease.
21429967 2011 In vivo activity of epoxide hydrolase according to sequence variation affects the progression of human IgA nephropathy.
21281786 2011 Arachidonic acid pathway members PLA2G7, HPGD, EPHX2, and CYP4F8 identified as putative novel therapeutic targets in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
21164107 2011 Redox regulation of soluble epoxide hydrolase by 15-deoxy-delta-prostaglandin J2 controls coronary hypoxic vasodilation.
21098312 2011 Genetic variation in soluble epoxide hydrolase (EPHX2) is associated with forearm vasodilator responses in humans.
20934334 2010 Substituted pyrazoles as novel sEH antagonist: investigation of key binding interactions within the catalytic domain.
20888937 2010 DNA methylation of the promoter of soluble epoxide hydrolase silences its expression by an SP-1-dependent mechanism.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20065888 2010 Homozygosity for the EPHX2 K55R polymorphism increases the long-term risk of ischemic stroke in men: a study in Swedes.
19969453 2010 Optimization of piperidyl-ureas as inhibitors of soluble epoxide hydrolase.
19940276 2010 Genetically reduced soluble epoxide hydrolase activity and risk of stroke and other cardiovascular disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19814804 2009 Variation in the human soluble epoxide hydrolase gene and risk of restenosis after percutaneous coronary intervention.
19746975 2009 Structure-based optimization of arylamides as inhibitors of soluble epoxide hydrolase.
19704161 2009 Inhibition of the soluble epoxide hydrolase by tyrosine nitration.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18974052 2008 Opposite regulation of cholesterol levels by the phosphatase and hydrolase domains of soluble epoxide hydrolase.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18784359 2008 Polymorphisms in phase I and phase II metabolism genes and risk of chronic benzene poisoning in a Chinese occupational population.
18775727 2008 Insights into the catalytic mechanism of human sEH phosphatase by site-directed mutagenesis and LC-MS/MS analysis.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18589104 2008 Genetic variations in soluble epoxide hydrolase and graft function in kidney transplantation.
18537101 2008 Genetic analysis of the soluble epoxide hydrolase gene, EPHX2, in subclinical cardiovascular disease in the Diabetes Heart Study.
18513744 2008 Protein quaternary structure and expression levels contribute to peroxisomal-targeting-sequence-1-mediated peroxisomal import of human soluble epoxide hydrolase.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18323494 2008 Genetic variation in soluble epoxide hydrolase (EPHX2) is associated with an increased risk of ischemic stroke in white Europeans.
18319271 2008 Distribution and expression of soluble epoxide hydrolase in human brain.
18216721 2008 Genetic variation in cytochrome P450 2J2 and soluble epoxide hydrolase and risk of ischemic stroke in a Chinese population.
18078836 2008 Transcriptional regulation of the human soluble epoxide hydrolase gene EPHX2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17919073 2007 Cytochrome P4501A1 and microsomal epoxide hydrolase gene polymorphisms: gene-environment interaction and risk of prostate cancer.
17498780 2007 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers.
17495027 2007 Angiotensin II up-regulates soluble epoxide hydrolase in vascular endothelium in vitro and in vivo.
17460077 2007 Polymorphisms in the human soluble epoxide hydrolase gene EPHX2 linked to neuronal survival after ischemic injury.
16957870 2006 Distribution of soluble epoxide hydrolase, cytochrome P450 2C8, 2C9 and 2J2 in human malignant neoplasms.
16595607 2006 Genetic variation in soluble epoxide hydrolase (EPHX2) and risk of coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) study.
16545818 2007 Sequence variation in the soluble epoxide hydrolase gene and subclinical coronary atherosclerosis: interaction with cigarette smoking.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16414022 2006 Effects of human soluble epoxide hydrolase polymorphisms on isoprenoid phosphate hydrolysis.
16322563 2006 Human soluble epoxide hydrolase: structural basis of inhibition by 4-(3-cyclohexylureido)-carboxylic acids.
16314446 2006 Cell-specific subcellular localization of soluble epoxide hydrolase in human tissues.
16202848 2005 The Prevalence of CYP2C8, 2C9, 2J2, and soluble epoxide hydrolase polymorphisms in African Americans with hypertension.
16115816 2005 The soluble epoxide hydrolase gene harbors sequence variation associated with susceptibility to and protection from incident ischemic stroke.
15845398 2005 Association of soluble epoxide hydrolase gene polymorphism with insulin resistance in type 2 diabetic patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196990 2004 Polymorphisms in human soluble epoxide hydrolase: effects on enzyme activity, enzyme stability, and quaternary structure.
15096040 2004 Structure of human epoxide hydrolase reveals mechanistic inferences on bifunctional catalysis in epoxide and phosphate ester hydrolysis.
14732757 2004 Polymorphism of the soluble epoxide hydrolase is associated with coronary artery calcification in African-American subjects: The Coronary Artery Risk Development in Young Adults (CARDIA) study.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673705 2004 Soluble epoxide hydrolase variant (Glu287Arg) modifies plasma total cholesterol and triglyceride phenotype in familial hypercholesterolemia: intrafamilial association study in an eight-generation hyperlipidemic kindred.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
12869654 2003 Polymorphisms in human soluble epoxide hydrolase.
12574510 2003 The soluble epoxide hydrolase encoded by EPXH2 is a bifunctional enzyme with novel lipid phosphate phosphatase activity.
12574508 2003 The N-terminal domain of mammalian soluble epoxide hydrolase is a phosphatase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11692079 2001 Genetic polymorphisms of microsomal and soluble epoxide hydrolase and the risk of Parkinson's disease.
10862610 2000 Identification and functional characterization of human soluble epoxide hydrolase genetic polymorphisms.
8619856 1996 Structural characterization of the human soluble epoxide hydrolase gene (EPHX2).
8342951 1993 cDNA cloning and expression of a soluble epoxide hydrolase from human liver.
8224376 1993 Properties of enzymes hydrating epoxides in human epidermis and liver.
7868134 1995 Localization of the human soluble epoxide hydrolase gene (EPHX2) to chromosomal region 8p21-p12.
7840649 1995 Metabolism of epoxyeicosatrienoic acids by cytosolic epoxide hydrolase: substrate structural determinants of asymmetric catalysis.
6667124 1983 Cytosolic epoxide hydrolase in fetal and adult human liver.
6185139 1982 Purification of human liver cytosolic epoxide hydrolase and comparison to the microsomal enzyme.
3222228 Cytosolic epoxide hydrolase in human placenta.
2995393 1985 Enzymatic hydration of leukotriene A4. Purification and characterization of a novel epoxide hydrolase from human erythrocytes.
2329521 1990 Cytochrome P 450 isoenzymes, epoxide hydrolase and glutathione transferases in rat and human hepatic and extrahepatic tissues.
1809223 1991 Genetic factors that regulate cytosolic epoxide hydrolase activity in normal human lymphocytes.
1423213 1992 Levels of cytochrome P-450, steroidogenesis and microsomal and cytosolic epoxide hydrolases in normal human adrenal tissue and corresponding tumors.
1349227 1992 Cigarette smoke inhibits cytosolic but not microsomal epoxide hydrolase of human lung.