Property Summary

NCBI Gene PubMed Count 340
PubMed Score 590.48
PubTator Score 435.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
pre-eclampsia 67 0.0 5.0
Disease Target Count
Familial hypercholanemia 3

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis -2.200 9.3e-03
gastric cancer -1.200 3.5e-02
malignant mesothelioma -3.000 1.3e-08
oligodendroglioma 1.200 7.5e-03
esophageal adenocarcinoma -1.300 2.1e-02
psoriasis -3.200 5.2e-06
atypical teratoid / rhabdoid tumor 2.600 3.1e-05
glioblastoma 2.300 1.6e-07
medulloblastoma, large-cell 1.100 3.1e-02
pancreatic ductal adenocarcinoma liver m... -3.497 4.6e-03
intraductal papillary-mucinous adenoma (... -1.500 3.1e-03
intraductal papillary-mucinous carcinoma... -1.600 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.1e-02
lung cancer -1.300 1.1e-03
active Crohn's disease -2.063 4.1e-02
ulcerative colitis -1.600 3.2e-06
pancreatic cancer -1.500 2.0e-03
fibroadenoma -1.300 3.9e-02
interstitial cystitis -1.400 5.5e-03
Breast cancer 1.100 1.3e-04
ductal carcinoma in situ -1.300 2.0e-02
invasive ductal carcinoma -1.500 1.1e-02
ovarian cancer -1.400 4.9e-05
pituitary cancer -1.100 2.9e-02
Down syndrome 1.800 4.2e-04
dermatomyositis -1.600 1.6e-04

Protein-protein Interaction (2)

Gene RIF (376)

PMID Text
26555147 The SCN1A IVS5-91G>A SNP is associated with susceptibility to epilepsy. SNPs in EPHX1 gene are influencing CBZ metabolism and disposition
26295053 In conclusion, GSTs, EPHX1, and XPD are potential genetic factors for arsenic-induced skin cancers. The roles of these genes for arsenic-induced skin carcinogenesis need to be further evaluated.
26216302 Studies suggest that the presence of microsomal epoxide hydrolase 1 (EPHX1) single nucleotide polymorphisms (SNPs) may significantly affect the risk of lung, upper aerodigestive tract, breast, bladder, and ovarian carcinomas.
26179485 Null-GSTT1 and null-GSTM1 genotypes and Cytochrome P4502E1 (CYP2E1: rs2031920, rs3813867) may support the hematotoxicity of benzene-exposed workers in China, and we can make use of it to select susceptible population
26065263 This meta-analysis suggests that EPHX1 Tyr113His polymorphism contributes to HCC risk.
25999707 Polymorphism in the EPHX1 gene may have a significant role in differential responses to treatment with N-acetylcysteine in patients with COPD.
25992604 To be poly(ADP-ribose)polymerase-1 (PARP-1) bound to the EPHX1 proximal promoter.
25923690 This review and meta-analysis suggests that EPHX1 Tyr113His polymorphism may be a risk factor for Head and Neck Cancer, while the EPHX1 His139Arg polymorphism has no association with Head and Neck Cancer risk.
25714851 EPHX1 Tyr113His and His139Arg polymorphism are not associated with esophageal cancer risk.
25629049 EPHX1 rs2292566 polymorphism may affect the maintenance dose of warfarin in Caucasians.
25495409 The ABCB1 was significantly associated with the CDR . CYP3A4*1G and CYP3A5*3 could influence CBZ metabolism, while POR*28 had no effect on it. The EPHX1 were significantly associated with CBZD:CBZE ratio.
25312477 the genetic associations exist between mEH polymorphisms and lung cancer susceptibility in Asian populations
25261893 His/His genotype of EPHX1 Tyr113His polymorphism is a risk factor for developing caner for Asian and mixed population, while no evidence was found for the association between the EPHX1 His139Arg polymorphism and increased cancer risk.
25222243 the EPHX1 Tyr113His polymorphism may be a risk factor for lung cancer in Asians, whereas it may be a decreased risk factor among Caucasians. However, this polymorphism was not found to be associated with breast cancer.
24958911 These results demonstrate that 2-AG is an endogenous substrate for EPHX1, a potential role of EPHX1 in the endocannabinoid signaling and a new AA biosynthetic pathway.
24861996 The C allele and C-G diplotype of EPHX1 may play important roles in increasing the risk of CBZ-SJS/toxic epidermal necrolysis development of epilepsy in Chinese Han patients.
24852519 No clear effect is evident for EPHX1 polymorphisms for different radon concentrations on the risk of lung cancer.
24803829 Review/Meta-analysis: suggest p.Tyr113His and p.His139Arg polymorphisms in EPHX1 may not be associated with esophageal cancer development.
24615030 Meta-analysis showed that the Tyr113His polymorphism was a stronger power trend towards risk for esophageal cancer using a recessive model
24505354 This study provides direct evidence that methylation plays an important role in PCOS and demonstrates a novel role for EPHX1 in female reproduction.
24315822 Sp1 and Sp3 are functionally involved as transcriptional integrators regulating the basal expression of the derived microsomal epoxide hydrolase E1b variant transcript.
24222229 No evidence of an association of EPHX1 Tyr113His or His139Arg polymorphisms with risk for development of esophageal cancer. [Meta-analysis]
24125961 Chinese epilepsy patients with variant EPHX1 c.416A>G genotype have higher plasma carbamazepine concentrations compared to those with the wild type genotype.
24013430 The association of EPHX1 polymorphism with the HELLP syndrome and eclampsia may hint to EPHX being a further key player in the pathogenesis of preeclampsia.
23955801 EPHX1 genetic polymorphisms were not associated with the risk of HCC.
23949201 Data indicate that genetic polymorphisms of aflatoxin B1 (AFB1) metabolic enzymes CYP2E1, EPHX1, GSTM1, and GSTT1 were not associated with gastric cancer, with the exception of CYP1A2.
23928928 Results suggest that Exons 3 and 4 polymorphisms of the mEH gene may contribute to lung cancer susceptibility through disturbed antioxidant balance.
23797950 findings suggest that benzene exposure may be associated with hypermethylation in ERCC3, and that genetic variants in EPHX1 may play an important role in epigenetic changes and hematotoxicity among benzene-exposed workers
23681797 This meta-analysis suggests that EPHX1 His139Arg polymorphism is associated with decreased risk of esophageal cancer in Caucasians.
23651475 Genotype frequencies for EPHX1 polymorphisms did not show any correlation with lymphoma.
23580125 The study showed that microsomal epoxide hydrolase exon 3 113Tyr-139Arg was associated with gastric cancer in presence of H. pylori, though in its absence, it appeared to be protective.
23564882 EPHX1 transcript, termed E1-b', drives EPHX1 expression primarily in the ovary.
23451147 There is substantial evidence that mEH polymorphisms interact synergistically with other genes and the environment to modulate risk of HCC
23378225 Microsomal epoxide hydrolase 1 T113C polymorphism is associated with lung cancer.
23055191 Meta-analyses of available data supported the concept of EPHX1 A139G polymorphism as a genetic susceptibility factor for lung cancer
22994552 the maternal EPHX1 rs1051740 genotype (RR = 3.26, P = .01) was associated with medulloblastoma risk.
22986331 Study analyzed the association between four SNPs in the EPHX1 and EPHX2 and the risk of oligozoospermia and asthenospermia; rs1051740, rs2234922 and rs751141 were not associated with oligozoospermia and asthenospermia and rs1042064 was a protective factor in idiopathic male infertility.
22928041 EPHX1 Tyr113His polymorphism may be not associated with CRC development
22788361 genetic association studies in population of plastics workers in Portugal: investigation of association of genetic polymorphism in EPHX1 and susceptibility to DNA damage/sister chromatid exchange from occupational exposure to styrene
22664944 The CYP1A1*2A (T/C, C/C), mEPHX*3 (His/His), GSTM1 (null), GSTT1 (null) and XRCC1 399 (Arg/Gln, Gln/Gln) alleles correlate with an increased predisposition to ulcerative colitis.
22555758 minor Tyr113 allele of mEPHX1 polymorphism had a higher risk of type 2 diabetes mellitus
22524818 Low microsomal epoxide hydrolase expression is associated with bladder carcinogenesis and recurrence.
22447130 the polymorphisms in exon 3 and exon 4 of the EPHX1 gene do not seem to be modifiers of esophageal squamous cell carcinoma or esophageal adenocarcinoma risk in Dutch Caucasians.
22352736 Exon 3 Tyr113His and exon 4 His139Arg polymorphisms of EPHX1 are risk factors for colorectal cancer in Turkey.
22257321 EPHX1 gene polymorphisms and haplotypes are associated with an increased risk for alcoholism in the Kota Indian population
22188362 the present study revealed that EPHX1, UGT2B7 and SCN1A genetic polymorphisms simultaneously modulated the CBZ maintenance doses and CDRs(concentration-dose ratios)
22156006 microsomal epoxide hydrolase polymorphism is associated with chromosomal instability of 1,3-butadiene exposed workers.
22118311 Polymorphism of microsomal epoxide hydrolase is associated with chronic obstructive pulmonary disease and bronchodilator response.
22103900 There was no overall association between prostate cancer risk & functional polymorphisms of EPHX1 gene in exon 3 or 4. A significant interaction of smoking & the exon 4 polymorphism was present.
21983886 individuals with EPHX1 113His/His slow activity genotype may not detoxify reactive carcinogenic epoxides efficiently, binding of reactive epoxides to DNA cause DNA damage.
21883387 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione
21841461 A statistically significant difference is found between preeclampsia patients and controls as relates to EPHX1 exon 4 genotype.
21734345 Combined EPHX1, GSTP1, GSTM1, and GSTT1 genetic polymorphisms may play a signi fi cant role in the development of pulmonary emphysema.
21651746 This is the first report that examined HIF1A polymorphisms in chronic obstructive pulmonary disease and demonstrated a possible role of HIF-1alpha in COPD, as well as GSTP1 and EPHX1.
21649467 EPHX1 polymorphism is associated with lung cancer susceptibility in Indian population.
21598178 There was no association between mEH genotype and colorectal polyps, nor were any statistically significant gene-environment interactions identified.
21593757 EPHX1 does not play a key role in mediating or predicting response to warfarin in an Italian population.
21480392 Data indicate that further studies of EPHX1 rs1051740, ADH4 r1042364, and NQO1 rs291766 are needed to make more definitive conclusion on the role of variation in xenobiotic metabolism in ovarian cancer.
21453055 EPHX1 gene polymorphisms and haplotypes were not involved in the susceptibility to oral cancer in South Indian subjects.
21445251 Putative low EPHX1 enzyme activity may have a potential protective effect on tobacco-related carcinogenesis of lung and UADT cancers, whereas putative high EPHX1 activity may have a harmful effect
21309732 combined genetic polymorphisms of GSTM1, GSTT1, GSTP1, and EPHX1 may have favorable effects on redox balance in chronic obstructive pulmonary disease patients.
21302624 Data suggest that the exon 3 Tyr113His and exon 4 His139Arg polymorphisms of EPHXI may be associated with a increased risk of lung cancer and a worse prognosis.
21254355 Our results suggest that there is an association between CYP1A1 and an interaction between EPHX1 and NAT2 xenobiotic metabolism genes and an increased risk for clubfoot.
21228718 the GST theta;1-null genotype and the 139A--G mEh gene polymorphism may enhance the susceptibility to acquired aplastic anemia
21228703 Microsomal epoxide hydrolase and N-acetyltransferase 2 genotypes appear not to be individual risk factors of inflammatory bowel disease, or to be important in relation to phenotypic characteristics of inflammatory bowel disease.
21228414 Weak, nonsignificant overall association between benzene and diffuse large B-cell lymphoma (OR 1.29, 95% CI: 0.84, 1.98) was increased among women AA for rs2234922 in the EPHX1 gene (OR 1.77, 95% CI: 1.06, 2.97; P(interaction) 0.06).
21192345 Despite a significant finding in rs1877724, which concurs with an earlier study, overall, genetic variants in EPHX1 do not have a clinically significant impact on warfarin dose requirements in our population.
21183608 Children with high EPHX1 activity may have increase risk of asthma and wheezing outcomes, and can be mediated through airway oxidative stress generation.
21057703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21044285 The "slow" activity-associated genotypes of EPHX1 were associated with increased risk of COPD.
21044285 Observational study of gene-disease association. (HuGE Navigator)
20951227 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20935060 Observational study of gene-disease association. (HuGE Navigator)
20932192 these results showed that there is a weak relation between 113His EPHX1 genotype and COPD, and no apparent relation between 139Arg and COPD in the studied Tunisian population.
20932192 Observational study of gene-disease association. (HuGE Navigator)
20886582 Single nucleotide polymorphisms of EPHX1 is associated with colorectal cancer.
20886582 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20878130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20847076 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20842355 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20731606 the association between glutathione S-transferase M1 (GSTM1), GSTT1, GSTP1, EPHX1, and p53 codon 72 polymorphisms as risk factors in 120 adult acute myeloid leukemia
20731606 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20716240 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20659238 EPHX1 exon 4 139His/Arg, and 139Arg/Arg genotypes were associated with a higher risk of esophageal cancer in a high-risk area of India.
20659238 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20637790 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602612 Functional variants from the gene encoding EPHX1 were highly polymorphic in North Indian epilepsy patients, and might account for differential drug response to first-line anticonvulsants.
20602612 Observational study of gene-disease association. (HuGE Navigator)
20568895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20525719 Observational study of gene-disease association. (HuGE Navigator)
20516053 EPHX1 polymorphisms do not have major roles in COPD or asthma in the Danish population
20516053 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20233420 Observational study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20095411 Genetic peculiarities particularly xenobiotic detoxification enzymes CYP1A1, CYP2E1, EPHX1 and GSTM1, GSTT1 play important role in pulmonary diseases development.
20095411 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20091863 Modifying effect of EPHX1 polymorphisms on the risk of early-onset lung cancer.M
20091863 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19952982 maternal polymorphisms may be associated with risk of fetal anomalies among pregnant women taking phenytoin
19952982 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19794411 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19754350 In India, 113Tyr-139Arg and 113His-139His haplotypes of mEPHX significantly elevated the risk for hepatocellular carcinoma by 1.4- and 1.5-folds, respectively.
19754350 Observational study of gene-disease association. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19736056 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19657367 Single nucleotide polymorphism in EPHX1 gene is associated with bone disease in myeloma.
19657367 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19620853 This proof-of-principle study suggests that genetic variants in EPHX1 can be used to predict maintenance doses of carbamazepine.
19620853 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593802 EPHX1, NQO1, and MPO variant genotypes were significantly associated with a reduced risk of childhood acute lymphoblastic leukemia
19593802 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19589345 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19528831 Characterize a series of polymorphisms of genes, such as CYP2E1, GSTM1, GSTT1, and particularly EPHX1, involved in butadine (BD) metabolism in very low BD exposure level.
19528831 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19479063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19364907 Upstream EPHX1 promoter polymorphisms are associated with reduced transcriptional activities and may represent important contributors to interindividual differences in EPHX1 activity.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19330589 Observational study of genotype prevalence. (HuGE Navigator)
19307236 Observational study of gene-disease association. (HuGE Navigator)
19287329 Results show that The EPHX1 Y113H variant is not associated with pancreatic diseases indicating that EPHX1 does not play a significant role in the initiation of pancreatic inflammation or cancer.
19287329 Observational study of gene-disease association. (HuGE Navigator)
19181923 EPHX1 polymorphisms do not have an effect on the level or change of forced expiratory volume
19181923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19162321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131562 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19111454 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19017876 in severe COPD, SNPs in EPHX1 and SERPINE2 were associated with hypoxemia in two separate study populations, and SNPs from SFTPB were associated with pulmonary artery pressure
19017876 Observational study of gene-disease association. (HuGE Navigator)
19012698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18836923 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18816171 GST and mEPHX variants share a positive association with viral-related hepatocellular carcinoma risk in Indian population.
18816171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18811882 The polymorphisms of EPHX1 113 and EPHX1 139 are genetic contributors to COPD susceptibility in Asian populations. The phenotypes of EPHX1 were contributors to overall COPD susceptibility.
18811882 Meta-analysis of gene-disease association. (HuGE Navigator)
18784359 genetic polymorphisms in EPHX1 may contribute to risk of chronic benzene poisoning in a Chinese occupational population.
18784359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18768509 EPHX1 polymorphisms were not associated with an earlier age of onset for colorectal neoplasms.
18768509 Observational study of gene-disease association. (HuGE Navigator)
18680736 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18642288 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18619701 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18614560 analysis of microsomal epoxide hydrolase and glutamate-cysteine ligase variants in COPD
18614560 Observational study of gene-disease association. (HuGE Navigator)
18571762 analysis of lung cancer in subjects under age 45 supports the hypothesis that EPHX1 polymorphisms may have a role in cancer susceptibility in this age group.
18571762 Observational study of gene-disease association. (HuGE Navigator)
18569587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18550614 Observational study of gene-disease association. (HuGE Navigator)
18513744 These results provide a mechanistic basis for understanding the cell-specific and tissue-specific localization of hsEH in vivo.
18510611 Observational study of gene-disease association. (HuGE Navigator)
18495522 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18461673 The researchers found evidence that the homozygus exon 3 mutatnt variant of the EPHX1 gene when combined with the GSTM1 null genotype is associated with an increased risk of COPD in a Slovak population.
18461673 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18423013 mEH (C/C) mutant and the NAT2 slow acetylator genotypes were significantly associated with breast carcinoma risk (p = 0.02; p = 0.01.
18423013 Observational study of gene-disease association. (HuGE Navigator)
18406439 gene-environment interaction of EPHX1 genotypes with tobacco, alcohol and occupational exposures did not appear to modulate the cancer susceptibility
18406439 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18394656 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18383527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18298806 C-Allele of EPHX1(His113Tyr)plays a protective role in early onset lung cancer susceptibility
18298806 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18258609 Observational study of gene-disease association. (HuGE Navigator)
18200441 our study demonstrated that exon 3 His genotype of the mEH are more prone to the risk of sporadic bladder cancer in North India
18093316 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18093316 The biotransformation enzymes GSTM1, GSTP1 and EPHX1 may modify the effect of dietary factors on the risk of developing colorectal carcinoma and adenoma.
17996038 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17908297 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17896209 Observational study of gene-disease association. (HuGE Navigator)
17885617 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17767854 The interaction between the polymorphisms of mEH gene and the indoor air pollution plays an important role in the carcinogenesis of lung.
17767854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17711870 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17695473 Observational study of gene-disease association. (HuGE Navigator)
17690329 Observational study of gene-disease association. (HuGE Navigator)
17686149 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17611777 EPHX1 polymorphism is not associated with the risk of head and neck cancer
17611777 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17608547 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17608547 genetic variation of the detoxification enzymes EPHX1 and GSTP1 do not increase the risks of orofacial clefting, nor do they influence the risks associated with maternal smoking.
17590289 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17588204 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17564249 Observational study of gene-disease association. (HuGE Navigator)
17564249 Finds neither EPHX1 exon 3 nor EPHX1 exon 4 polymorphisms are associated with an increased risk of COPD. Finds also that none of the EPHX1 haplotypes are associated with an increased risk of any COPD phenotype.
17548691 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17548684 Observational study of gene-disease association. (HuGE Navigator)
17532303 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17532303 In conclusion, 105V/114V alleles of GSTP1 and 113H/139H alleles of mEPHX and the combination of genotypes with same alleles associated with imbalanced oxidative stress and lung function in patients.
17526865 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17526865 EPHX1 genotypes modified the association between maternal passive smoking and infant birth weight, which is suggestive of possible gene-environment interaction.
17498780 Observational study of gene-disease association. (HuGE Navigator)
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17416773 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17416769 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17412371 Observational study of gene-disease association. (HuGE Navigator)
17380322 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17380322 EPHX1 genotype was not associated with risk of myocardial infarction, regardless of smoking status, suggesting EPHX1 does not play a significant role in the development of coronary heart disease.
17365145 Observational study of genotype prevalence. (HuGE Navigator)
17363767 Observational study of gene-disease association. (HuGE Navigator)
17363767 Polymorphic variants in EPHX1 are associated with both emphysema distribution and COPD susceptibility
17273734 Observational study of genotype prevalence. (HuGE Navigator)
17273734 the expression level of mEH is as important as genetic polymorphism in non-small cell lung cancer; could be involved in drug resistance and prognosis of patients
17212663 Observational study of gene-disease association. (HuGE Navigator)
17212663 Genetic variability in exon 3 and 4 of EPHX may be a risk factor for pre-eclampsia.
17203192 Observational study of gene-disease association. (HuGE Navigator)
17203192 Genetic polymorphisms in HOX-1 and mEPH genes are associated with the development of COPD in Southwest China
17167268 Observational study of gene-disease association. (HuGE Navigator)
17164366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17159790 Observational study of gene-disease association. (HuGE Navigator)
17159790 Low EPHX1 activity genotype may be protective for people occupationally exposed to asbestos.
17082176 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17082176 EPHX1 gene polymorphisms is associated with sporadic distal colorectal adenomas
17078101 Observational study of gene-disease association. (HuGE Navigator)
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17035385 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17022435 Observational study of gene-disease association. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16926176 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16697254 Observational study of gene-disease association. (HuGE Navigator)
16630050 The present study demonstrates a significant increase in mEH expression in the AD hippocampus, a region showing abundant neuropathology in AD.
16614120 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16614101 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16598069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16585076 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16535827 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16456143 Observational study of gene-disease association. (HuGE Navigator)
16369102 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16357600 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16201204 Observational study of gene-disease association. (HuGE Navigator)
16201204 Results suggest that polymorphisms at codon 113 and 139 in microsomal epoxide hydrolase do not play a significant role in susceptibility to the mutagenic effects of vinyl chloride occupational exposure.
16147638 Observational study of gene-disease association. (HuGE Navigator)
16125881 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16039674 Observational study of gene-disease association. (HuGE Navigator)
16029924 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16029924 the mEH His113His genotype can differentiate the association between smoking, areca chewing, and esophageal squamous-cell-carcinoma
16006997 Observational study of gene-disease association. (HuGE Navigator)
16005144 Observational study of gene-disease association. (HuGE Navigator)
15938845 Observational study of gene-disease association. (HuGE Navigator)
15928955 Observational study of gene-disease association. (HuGE Navigator)
15924351 individuals exposed to tobacco carcinogens were at increased risk of colorectal cancer and that overall risk is related to microsomal epoxide hydrolase and CYP2C9 genotype
15901990 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15900282 Observational study of gene-disease association. (HuGE Navigator)
15894702 Significant differences were not found for the risk of colon cancer and smoking for mEH genotype polymorphisms Y113H and H139R.
15838728 Observational study of gene-disease association. (HuGE Navigator)
15838728 Nuclear genetic polymorphisms related to oxidative stress or apoptosis may modify the age at onset of Leber's hereditary optic neuropathy (LHON).
15817713 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15774926 Observational study of gene-disease association. (HuGE Navigator)
15746160 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15734960 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15719050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15716486 Observational study of gene-disease association. (HuGE Navigator)
15714076 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, pharmacogenomic / toxicogenomic, and healthcare-related. (HuGE Navigator)
15702235 Observational study of gene-disease association. (HuGE Navigator)
15702235 results suggest that codon 113 polymorphism may modify risk for development of chronic obstructive pulmonary disease
15692831 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15668489 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15654505 Observational study of gene-disease association. (HuGE Navigator)
15640939 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15640939 The slow 113His EPHX1 allele tends to be more frequent among the patients with lung cancer than in normal controls
15640066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15582499 Observational study of gene-disease association. (HuGE Navigator)
15536330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15535985 In liver microsomes, no major differences were evident in the reaction rates generated among preparations representing the different EPHX1 alleles.
15531751 Results suggest that mEH "slow" genotypes increase the annual decline rate of lung function for subjects occupationally exposed to airborne endotoxin
15488121 Observational study of gene-disease association. (HuGE Navigator)
15466980 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15465926 Exon 1 sequence promoter functions as the primary driver of EPHX1 expression in human tissues.
15355699 Observational study of gene-disease association. (HuGE Navigator)
15352038 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15298956 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15280903 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15256148 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15199549 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15150264 EPHX1 expression is regulated by C/EBPalpha interacting with DNA-bound NF-Y
15138035 Observational study of gene-disease association. (HuGE Navigator)
15061915 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15036125 Observational study of gene-disease association. (HuGE Navigator)
14988221 Observational study of gene-disease association. (HuGE Navigator)
14984931 GATA-4 plays a transactivator role in the regulation of the transcription of the EPHX1 gene
14751678 Observational study of gene-disease association. (HuGE Navigator)
14719475 Observational study of gene-disease association. (HuGE Navigator)
14681495 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14669306 Observational study of gene-disease association. (HuGE Navigator)
14669306 Tyr113His polymorphism is not associated with susceptibility to esophageal squamous cell carcinoma in a population of North China.
14642084 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
12935919 Observational study of gene-disease association. (HuGE Navigator)
12915882 Observational study of gene-disease association. (HuGE Navigator)
12915882 polymorphisms in microsomal epoxide hydrolase associated with lung cancer risk
12854128 Observational study of gene-disease association. (HuGE Navigator)
12798882 Observational study of gene-disease association. (HuGE Navigator)
12760253 Observational study of gene-disease association. (HuGE Navigator)
12747973 Observational study of gene-disease association. (HuGE Navigator)
12717779 Observational study of gene-environment interaction. (HuGE Navigator)
12670526 Observational study of gene-disease association. (HuGE Navigator)
12670526 polymorphisms in microsomal epoxide hydrolase is associated with esophageal tumorigenesis
12631667 Observational study of gene-disease association. (HuGE Navigator)
12605384 Observational study of gene-disease association. (HuGE Navigator)
12579334 Observational study of gene-disease association. (HuGE Navigator)
12579334 Polymorphism in EPHX1 might be associated with development of emphysematous changes in the lung.
12552594 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12552594 A significant increase in risk for neoplasia was observed for the low-activity mEH 113 His allele after adjustment for smoking
12496064 Microsomal epoxide hydrolase variants are not associated with risk of breast neoplasms.
12491039 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12397416 Observational study of gene-disease association. (HuGE Navigator)
12376511 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12359356 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12359356 Polymorphisms in microsomal epoxide hydrolase is associated with laryngeal cancer
12234472 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
12173035 Observational study of gene-disease association. (HuGE Navigator)
12173035 Two exonic single nucleotide polymorphisms in the gene are jointly associated with preeclampsia.
12160895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12141066 Meta-analysis of gene-disease association. (HuGE Navigator)
12121132 evidence that microsomal epoxide hydrolase is a target for tamoxifen and that target proteins are implicated in cell lipid metabolism
12085365 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12085365 polymorphisms were significantly associated with hepatitis C virus-related liver disease severity and hepatocellular carcinoma risk
11967624 Observational study of gene-disease association. (HuGE Navigator)
11940289 Observational study of gene-disease association. (HuGE Navigator)
11859435 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11849215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11813302 Observational study of gene-disease association. (HuGE Navigator)
11809533 Polymorphisms in microsomal epoxide hydrolase is associated with ovarian cancer
11751440 Observational study of genotype prevalence. (HuGE Navigator)
11692079 Observational study of gene-disease association. (HuGE Navigator)
11692079 Common polymorphisms within EPHX1 do not appear to be important risk factors for Parkinson's disease.
11597790 Observational study of gene-disease association. (HuGE Navigator)
11551408 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11535253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11520401 Observational study of gene-disease association. (HuGE Navigator)
11489754 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11480169 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11471167 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11440964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11406608 Observational study of gene-disease association. (HuGE Navigator)
11375900 Observational study of gene-disease association. (HuGE Navigator)
11283205 Observational study of gene-disease association. (HuGE Navigator)
11255266 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11191882 Observational study of genotype prevalence. (HuGE Navigator)
11124296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF      1 - 70
RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT     71 - 140
PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK    141 - 210
LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE    211 - 280
LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS    281 - 350
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL    351 - 420
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ                                       421 - 455
//

Text Mined References (344)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26555147 2015 Polymorphic Variants of SCN1A and EPHX1 Influence Plasma Carbamazepine Concentration, Metabolism and Pharmacoresistance in a Population of Kosovar Albanian Epileptic Patients.
26295053 2015 Association of Environmental Arsenic Exposure, Genetic Polymorphisms of Susceptible Genes, and Skin Cancers in Taiwan.
26216302 2015 Microsomal epoxide hydrolase 1 (EPHX1): Gene, structure, function, and role in human disease.
26179485 Are polymorphisms in metabolism protective or a risk for reduced white blood cell counts in a Chinese population with low occupational benzene exposures?
26065263 [EPHX1 Tyr113His polymorphism contributes to hepatocellular carcinoma risk: evidfnce from a meta-analysis].
25999707 2015 Effect of N-acetylcysteine in COPD patients with different microsomal epoxide hydrolase genotypes.
25992604 2015 Transcription of the Human Microsomal Epoxide Hydrolase Gene (EPHX1) Is Regulated by PARP-1 and Histone H1.2. Association with Sodium-Dependent Bile Acid Transport.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25923690 2015 Systematic Review and Meta-Analysis of the Relationship between EPHX1 Polymorphisms and the Risk of Head and Neck Cancer.
25714851 Lack of association between EPHX1 polymorphism and esophageal cancer risk: evidence from meta-analysis.
25629049 2015 Influence of two common polymorphisms in the EPHX1 gene on warfarin maintenance dosage: a meta-analysis.
25495409 2014 Effects of major transporter and metabolizing enzyme gene polymorphisms on carbamazepine metabolism in Chinese patients with epilepsy.
25312477 2015 Impact of epoxide hydrolase 1 polymorphisms on lung cancer susceptibility in Asian populations.
25261893 2014 Quantitative assessment of the influence of EPHX1 gene polymorphisms and cancer risk: a meta-analysis with 94,213 subjects.
25222243 2014 Quantitative assessment of the effects of the EPHX1 Tyr113His polymorphism on lung and breast cancer.
24958911 2014 A novel activity of microsomal epoxide hydrolase: metabolism of the endocannabinoid 2-arachidonoylglycerol.
24861996 2014 Association of ABCB1, CYP3A4, EPHX1, FAS, SCN1A, MICA, and BAG6 polymorphisms with the risk of carbamazepine-induced Stevens-Johnson syndrome/toxic epidermal necrolysis in Chinese Han patients with epilepsy.
24852519 2014 Genetic susceptibility, residential radon, and lung cancer in a radon prone area.
24803829 2014 Association between esophageal cancer risk and EPHX1 polymorphisms: a meta-analysis.
24615030 2014 EPHX1 Tyr113His and His139Arg polymorphisms in esophageal cancer risk: a meta-analysis.
24505354 2014 Quantitative methylation level of the EPHX1 promoter in peripheral blood DNA is associated with polycystic ovary syndrome.
24315822 2014 Sp1 and Sp3 transcription factors regulate the basal expression of human microsomal epoxide hydrolase (EPHX1) through interaction with the E1b far upstream promoter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222229 2013 Meta-analysis demonstrates lack of an association of microsomal epoxide hydrolase 1 polymorphisms with esophageal cancer risk.
24125961 2013 Effects of EPHX1, SCN1A and CYP3A4 genetic polymorphisms on plasma carbamazepine concentrations and pharmacoresistance in Chinese patients with epilepsy.
24013430 2014 eNOSI4 and EPHX1 polymorphisms affect maternal susceptibility to preeclampsia: analysis of five polymorphisms predisposing to cardiovascular disease in 279 Caucasian and 241 African women.
23955801 2014 Lack of association of EPHX1 gene polymorphisms with risk of hepatocellular carcinoma: a meta-analysis.
23949201 2013 Dietary aflatoxin B1 intake, genetic polymorphisms of CYP1A2, CYP2E1, EPHX1, GSTM1, and GSTT1, and gastric cancer risk in Korean.
23928928 2014 Association between environmental tobacco smoke exposure and lung cancer susceptibility: modification by antioxidant enzyme genetic polymorphisms.
23797950 2013 Microsomal epoxide hydrolase (EPHX1) polymorphisms are associated with aberrant promoter methylation of ERCC3 and hematotoxicity in benzene-exposed workers.
23681797 2013 Association between microsomal epoxide hydrolase 1 polymorphisms and susceptibility to esophageal cancer: a meta-analysis.
23651475 2013 Polymorphisms in xenobiotic metabolizing genes (EPHX1, NQO1 and PON1) in lymphoma susceptibility: a case control study.
23580125 2013 Association of microsomal epoxide hydrolase exon 3 Tyr113His and exon 4 His139Arg polymorphisms with gastric cancer in India.
23564882 2013 Expression of a novel mRNA transcript for human microsomal epoxide hydrolase (EPHX1) is regulated by short open reading frames within its 5'-untranslated region.
23451147 2013 Meta-analysis of microsomal epoxide hydrolase gene polymorphism and risk of hepatocellular carcinoma.
23378225 2013 Association between microsomal epoxide hydrolase 1 T113C polymorphism and susceptibility to lung cancer.
23055191 2013 EPHX1 A139G polymorphism and lung cancer risk: a meta-analysis.
22994552 2012 Maternal variation in EPHX1, a xenobiotic metabolism gene, is associated with childhood medulloblastoma: an exploratory case-parent triad study.
22986331 2012 Genetic variants in epoxide hydrolases modify the risk of oligozoospermia and asthenospermia in Han-Chinese population.
22928041 2012 Systematic review and meta-analysis of the relationship between EPHX1 polymorphisms and colorectal cancer risk.
22788361 2012 DNA damage and susceptibility assessment in industrial workers exposed to styrene.
22664944 2013 Association of the CYP1A1*2A, GSTT1 null, GSTM1 null, mEPHX*3, and XRCC1-399 genetic polymorphisms with ulcerative colitis.
22555758 2012 Possible role of microsomal epoxide hydrolase gene polymorphism as a risk factor for developing insulin resistance and type 2 diabetes mellitus.
22524818 2012 Low microsomal epoxide hydrolase expression is associated with bladder carcinogenesis and recurrence.
22447130 2012 EPHX1 polymorphisms do not modify esophageal carcinoma susceptibility in Dutch Caucasians.
22352736 2012 Investigation of a possible relationship between EPHX1 gene polymorphisms and colorectal cancer in Turkish society.
22257321 2013 EPHX1 gene polymorphisms in alcohol dependence and their distribution among the Indian populations.
22188362 2012 Association of polymorphisms in EPHX1, UGT2B7, ABCB1, ABCC2, SCN1A and SCN2A genes with carbamazepine therapy optimization.
22156006 2012 Chromosomal damage and polymorphisms of metabolic genes among 1, 3-butadiene-exposed workers in a matched study in China.
22118311 2011 Polymorphism of microsomal epoxide hydrolase is associated with chronic obstructive pulmonary disease and bronchodilator response.
22103900 2012 Microsomal epoxide hydrolase polymorphisms, cigarette smoking and prostate cancer risk in the Slovak population.
21983886 2012 Association between polymorphisms of EPHX1 and XRCC1 genes and the risk of childhood acute lymphoblastic leukemia.
21883387 2012 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione.
21841461 2012 Genetic polymorphism of microsomal epoxide hydrolase enzyme gene in preeclamptic females.
21734345 2011 Combined analysis of EPHX1, GSTP1, GSTM1 and GSTT1 gene polymorphisms in relation to chronic obstructive pulmonary disease risk and lung function impairment.
21651746 2013 Genetic variations in detoxification enzymes and HIF-1? in Japanese patients with COPD.
21649467 2011 Association of functionally important polymorphism of microsomal epoxide hydrolase gene (EPHX1) with lung cancer susceptibility.
21598178 2011 Colorectal polyp type and the association with charred meat consumption, smoking, and microsomal epoxide hydrolase polymorphisms.
21593757 2011 EPHX1 polymorphisms are not associated with warfarin response in an Italian population.
21480392 2011 Xenobiotic-Metabolizing gene polymorphisms and ovarian cancer risk.
21453055 2011 Lack of association of EPHX1 genotypes and haplotypes with oral cancer in South Indians.
21445251 2011 Putative EPHX1 enzyme activity is related with risk of lung and upper aerodigestive tract cancers: a comprehensive meta-analysis.
21309732 2011 Correlation of EPHX1, GSTP1, GSTM1, and GSTT1 genetic polymorphisms with antioxidative stress markers in chronic obstructive pulmonary disease.
21302624 Polymorphisms in the microsomal epoxide hydrolase gene: role in lung cancer susceptibility and prognosis.
21269460 2011 Initial characterization of the human central proteome.
21254355 2011 Smoking, the xenobiotic pathway, and clubfoot.
21228718 2011 Genetic polymorphisms of glutathione-S-transferase and microsomal epoxide hydrolase in egyptian acquired aplastic anemia patients.
21228703 2011 Common polymorphisms in the microsomal epoxide hydrolase and N-acetyltransferase 2 genes in association with inflammatory bowel disease in the Danish population.
21228414 2011 Genetic variation in metabolic genes, occupational solvent exposure, and risk of non-hodgkin lymphoma.
21192345 2011 Exon sequencing and association analysis of EPHX1 genetic variants with maintenance warfarin dose in a multiethnic Asian population.
21183608 2011 Microsomal epoxide hydroxylase genotypes/diplotypes, traffic air pollution, and childhood asthma.
21057703 2011 Impact of pharmacokinetic (CYP2C9) and pharmacodynamic (VKORC1, F7, GGCX, CALU, EPHX1) gene variants on the initiation and maintenance phases of phenprocoumon therapy.
21044285 2010 Analyses of association between PPAR gamma and EPHX1 polymorphisms and susceptibility to COPD in a Hungarian cohort, a case-control study.
20951227 2011 Exposure to low environmental levels of benzene: evaluation of micronucleus frequencies and S-phenylmercapturic acid excretion in relation to polymorphisms in genes encoding metabolic enzymes.
20935060 2010 Genetic modifiers of carcinogen DNA adducts in target lung and peripheral blood mononuclear cells.
20932192 2010 Microsomal epoxide hydrolase gene polymorphisms and susceptibility to chronic obstructive pulmonary disease in the Tunisian population.
20886582 2010 Interactions between cigarette smoking and selected polymorphisms in xenobiotic metabolizing enzymes in risk for colorectal cancer: A case-only analysis.
20878130 2010 Association between exposure-relevant polymorphisms in CYP1B1, EPHX1, NQO1, GSTM1, GSTP1 and GSTT1 and risk of colorectal cancer in a Czech population.
20847076 2011 Genetic susceptibility to asbestos-related fibrotic pleuropulmonary changes.
20842355 2010 VKORC1-1639G>A, CYP2C9, EPHX1691A>G genotype, body weight, and age are important predictors for warfarin maintenance doses in patients with mechanical heart valve prostheses in southwest China.
20731606 2011 Association of glutathione S-transferase, EPHX, and p53 codon 72 gene polymorphisms with adult acute myeloid leukemia.
20716240 2010 New genetic variant that might improve warfarin dose prediction in African Americans.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20659238 2010 Role of epoxide hydrolase 1 gene polymorphisms in esophageal cancer in a high-risk area in India.
20637790 2010 Influence of GSTs, CYP2E1 and mEH polymorphisms on 1, 3-butadiene-induced micronucleus frequency in Chinese workers.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602612 2010 Genetic profile of patients with epilepsy on first-line antiepileptic drugs and potential directions for personalized treatment.
20568895 2010 Polymorphisms in metabolizing enzymes and the risk of head and neck squamous cell carcinoma in the Slavic population of the central Europe.
20525719 2011 Association of COPD candidate genes with computed tomography emphysema and airway phenotypes in severe COPD.
20516053 2011 EPHX1 polymorphisms, COPD and asthma in 47,000 individuals and in meta-analysis.
20461808 2010 A case-control study of Parkinson's disease and tobacco use: gene-tobacco interactions.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20233420 2010 Cluster analysis in severe emphysema subjects using phenotype and genotype data: an exploratory investigation.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20095411 2009 [Role of xenobiotic biotransformation enzymes in respiratory diseases caused by dust].
20091863 2010 Genetic polymorphisms of MPO, GSTT1, GSTM1, GSTP1, EPHX1 and NQO1 as risk factors of early-onset lung cancer.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19952982 2010 Maternal EPHX1 polymorphisms and risk of phenytoin-induced congenital malformations.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19794411 2010 Genetic factors (VKORC1, CYP2C9, EPHX1, and CYP4F2) are predictor variables for warfarin response in very elderly, frail inpatients.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19754350 2009 Haplotypes of microsomal epoxide hydrolase and x-ray cross-complementing group 1 genes in Indian hepatocellular carcinoma patients.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19736056 2009 Associations of common variants in genes involved in metabolism and response to exogenous chemicals with risk of multiple myeloma.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19657367 2009 Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19620853 Genetic variants in microsomal epoxide hydrolase influence carbamazepine dosing.
19593802 2010 Role of the CYP2D6, EPHX1, MPO, and NQO1 genes in the susceptibility to acute lymphoblastic leukemia in Brazilian children.
19589345 2009 Gene-smoking interaction on colorectal adenoma and cancer risk: review and meta-analysis.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19528831 2009 Influence of some detoxification enzyme polymorphisms on cytogenetic biomarkers between individuals exposed to very low doses of 1,3-butadiene.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19479063 2009 Phase I metabolic genes and risk of lung cancer: multiple polymorphisms and mRNA expression.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19364907 2009 The expression of human microsomal epoxide hydrolase is predominantly driven by a genetically polymorphic far upstream promoter.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19330589 2009 Polymorphisms in genes encoding drugs and xenobiotic metabolizing enzymes in a Brazilian population.
19307236 2009 Aromatic DNA adducts and polymorphisms in metabolic genes in healthy adults: findings from the EPIC-Spain cohort.
19287329 2009 The role of epoxide hydrolase Y113H gene variant in pancreatic diseases.
19181923 2009 No effects of EPHX1 polymorphisms on the level or change of FEV1 in the general population.
19177501 2009 Chromosomal aberrations in railroad transit workers: effect of genetic polymorphisms.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19162321 2009 Polymorphisms of xenobiotic metabolizing enzymes and DNA repair genes and outcome in childhood acute lymphoblastic leukemia.
19131562 2009 Biomarkers of human exposure to acrylamide and relation to polymorphisms in metabolizing genes.
19111454 2009 Genetic association analysis of COPD candidate genes with bronchodilator responsiveness.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19017876 2009 Genetic associations with hypoxemia and pulmonary arterial pressure in COPD.
19012698 2008 Cigarette smoking and glutathione S-transferase M1 polymorphism associated with risk for uterine cervical cancer.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18836923 2008 Genetic susceptibility to benzene toxicity in humans.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18816171 2008 Glutathione-S-transferase and microsomal epoxide hydrolase polymorphism and viral-related hepatocellular carcinoma risk in India.
18811882 2008 Association between polymorphisms of microsomal epoxide hydrolase and COPD: results from meta-analyses.
18784359 2008 Polymorphisms in phase I and phase II metabolism genes and risk of chronic benzene poisoning in a Chinese occupational population.
18768509 2008 Genetic variation in genes for the xenobiotic-metabolizing enzymes CYP1A1, EPHX1, GSTM1, GSTT1, and GSTP1 and susceptibility to colorectal cancer in Lynch syndrome.
18680736 2008 Genetic factors contribute to patient-specific warfarin dose for Han Chinese.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18642288 2008 Case-control study of oral and oropharyngeal cancer in whites and genetic variation in eight metabolic enzymes.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18619701 2008 DNA polymorphisms and response to treatment in patients with chronic hepatitis C: results from the HALT-C trial.
18614560 2008 Genetic variants of microsomal epoxide hydrolase and glutamate-cysteine ligase in COPD.
18571762 2009 Functional polymorphisms of the microsomal epoxide hydrolase gene: a reappraisal on a early-onset lung cancer patients series.
18569587 2008 Association between genetic polymorphisms in styrene-metabolizing enzymes and biomarkers in styrene-exposed workers.
18550614 2008 Polymorphic variation in surfactant protein B is associated with COPD exacerbations.
18513744 2008 Protein quaternary structure and expression levels contribute to peroxisomal-targeting-sequence-1-mediated peroxisomal import of human soluble epoxide hydrolase.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18495522 2008 Cytogenetic effects induced by Prestige oil on human populations: the role of polymorphisms in genes involved in metabolism and DNA repair.
18461673 2008 Glutathione S-transferase and microsomal epoxide hydrolase gene polymorphisms and risk of chronic obstructive pulmonary disease in Slovak population.
18423013 2008 Implication of Xenobiotic Metabolizing Enzyme gene (CYP2E1, CYP2C19, CYP2D6, mEH and NAT2) polymorphisms in breast carcinoma.
18406439 2008 Microsomal epoxide hydrolase (EPHX1), slow (exon 3, 113His) and fast (exon 4, 139Arg) alleles confer susceptibility to squamous cell esophageal cancer.
18394656 2008 Chromosomal aberrations in tire plant workers and interaction with polymorphisms of biotransformation and DNA repair genes.
18383527 2008 Microsomal epoxide hydrolase genotypes and the risk for head and neck cancer.
18298806 2008 Do genetic factors protect for early onset lung cancer? A case control study before the age of 50 years.
18258609 2008 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of non-small cell lung cancer in smokers.
18200441 2008 Genetic polymorphisms of cytochrome P450 CYP1A1 (*2A) and microsomal epoxide hydrolase gene, interactions with tobacco-users, and susceptibility to bladder cancer: a study from North India.
18093316 2007 Meat, vegetables and genetic polymorphisms and the risk of colorectal carcinomas and adenomas.
17996038 2007 Polymorphisms in metabolic genes, their combination and interaction with tobacco smoke and alcohol consumption and risk of gastric cancer: a case-control study in an Italian population.
17908297 2007 Primary DNA damage and genetic polymorphisms for CYP1A1, EPHX and GSTM1 in workers at a graphite electrode manufacturing plant.
17896209 2008 PAH-DNA adducts in a Chinese population: relationship to PAH exposure, smoking and polymorphisms of metabolic and DNA repair genes.
17885617 2007 Genetic polymorphisms and benzene metabolism in humans exposed to a wide range of air concentrations.
17767854 2007 [The interaction between microsomal epoxide hydrolase polymorphisms and indoor pollution in non small cell lung cancer].
17711870 2007 Microsomal epoxide hydrolase, glutathione S-transferase P1, traffic and childhood asthma.
17695473 Association between allelic polymorphisms of metabolizing enzymes (CYP 1A1, CYP 1A2, CYP 2E1, mEH) and occurrence of colorectal cancer in Hungary.
17690329 2008 IL10 polymorphisms are associated with airflow obstruction in severe alpha1-antitrypsin deficiency.
17686149 2007 Xenobiotic metabolizing enzyme gene polymorphisms predict response to lung volume reduction surgery.
17611777 2008 CYP1A1, CYP2E1, GSTM1, GSTT1, EPHX1 exons 3 and 4, and NAT2 polymorphisms, smoking, consumption of alcohol and fruit and vegetables and risk of head and neck cancer.
17608547 2007 Maternal smoking during early pregnancy, GSTP1 and EPHX1 variants, and risk of isolated orofacial clefts.
17590289 2007 Impact of air pollution and genotype variability on DNA damage in Prague policemen.
17588204 2008 Breast cancer: a candidate gene approach across the estrogen metabolic pathway.
17564249 2006 Microsomal epoxide hydrolase is not associated with COPD in a community-based sample.
17548691 2007 Associations between smoking, polymorphisms in polycyclic aromatic hydrocarbon (PAH) metabolism and conjugation genes and PAH-DNA adducts in prostate tumors differ by race.
17548684 2007 Path analysis of biomarkers of exposure and early biological effects among coke-oven workers exposed to polycyclic aromatic hydrocarbons.
17532303 2007 Genetic polymorphisms of GSTP1 and mEPHX correlate with oxidative stress markers and lung function in COPD.
17526865 2007 Passive smoking, metabolic gene polymorphisms, and infant birth weight in a prospective cohort study of Chinese women.
17498780 2007 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers.
17449559 2007 Gene-environment interactions in parkinsonism and Parkinson's disease: the Geoparkinson study.
17416773 2007 Exposure to ethylene oxide in hospitals: biological monitoring and influence of glutathione S-transferase and epoxide hydrolase polymorphisms.
17416769 2007 A systematic approach to analysing gene-gene interactions: polymorphisms at the microsomal epoxide hydrolase EPHX and glutathione S-transferase GSTM1, GSTT1, and GSTP1 loci and breast cancer risk.
17412371 2007 PAH-DNA adducts in environmentally exposed population in relation to metabolic and DNA repair gene polymorphisms.
17380322 2007 Microsomal epoxide hydrolase genotype and risk of myocardial infarction.
17365145 Polymorphisms of microsomal epoxide hydrolase and glutathione S-transferase P1 in a male Turkish population.
17363767 2007 Genetic determinants of emphysema distribution in the national emphysema treatment trial.
17273734 2007 Genetic polymorphism and gene expression of microsomal epoxide hydrolase in non-small cell lung cancer.
17212663 2007 Association of microsomal epoxide hydrolase gene polymorphism and pre-eclampsia in Turkish women.
17203192 2007 Relationship between COPD and polymorphisms of HOX-1 and mEPH in a Chinese population.
17167268 2007 Susceptibility to pre-eclampsia is associated with multiple genetic polymorphisms in maternal biotransformation enzymes.
17164366 2006 Polymorphisms in metabolic genes related to tobacco smoke and the risk of gastric cancer in the European prospective investigation into cancer and nutrition.
17159790 2006 Genetic predisposition and health effect of occupational exposure to asbestos.
17082176 2007 Role of NQO1C609T and EPHX1 gene polymorphisms in the association of smoking and alcohol with sporadic distal colorectal adenomas: results from the UKFSS Study.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
17035385 2006 Comparison of polymorphisms in genes involved in polycyclic aromatic hydrocarbon metabolism with urinary phenanthrene metabolite ratios in smokers.
17022435 2006 Genetic polymorphism of metabolic enzymes modifies the risk of chronic solvent-induced encephalopathy.
16985026 2006 Metabolic gene variants and risk of non-Hodgkin's lymphoma.
16926176 2007 Inherited variation in carcinogen-metabolizing enzymes and risk of colorectal polyps.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16697254 2006 Metabolic genotypes as modulators of asbestos-related pleural malignant mesothelioma risk: a comparison of Finnish and Italian populations.
16630050 2006 Expression of microsomal epoxide hydrolase is elevated in Alzheimer's hippocampus and induced by exogenous beta-amyloid and trimethyl-tin.
16614120 2006 Polymorphisms in polycyclic aromatic hydrocarbon metabolism and conjugation genes, interactions with smoking and prostate cancer risk.
16614101 2006 Interindividual variations in DNA adduct levels assessed by analysis of multiple genetic polymorphisms in smokers.
16598069 2006 Variation in genes relevant to aromatic hydrocarbon metabolism and the risk of adult brain tumors.
16585076 2006 Genetic association between COPD and polymorphisms in TNF, ADRB2 and EPHX1.
16538176 2006 Genetic susceptibility to carbamazepine-induced cutaneous adverse drug reactions.
16535827 2005 [Study on the relationship between DNA damage and polymorphisms of metabolizing enzymes of vinyl chloride monomer-exposed workers].
16456143 2006 Genetic association analysis of functional impairment in chronic obstructive pulmonary disease.
16369102 2006 Genetic and environmental factors associated with the development of hypertension in pregnancy.
16357600 2006 EPHX1 polymorphisms and the risk of lung cancer: a HuGE review.
16201204 2005 Polymorphisms of microsomal epoxide hydrolase in French vinyl chloride workers.
16147638 2004 Maternal and fetal single nucleotide polymorphisms in the epoxide hydrolase and gluthatione S-transferase P1 genes are not associated with pre-eclampsia in the Coloured population of the Western Cape, South Africa.
16125881 2005 Influence of genetic polymorphisms of styrene-metabolizing enzymes and smoking habits on levels of urinary metabolites after occupational exposure to styrene.
16043197 2006 Genetic polymorphisms and possible gene-gene interactions in metabolic and DNA repair genes: effects on DNA damage.
16039674 2006 Role of epoxide hydrolase, NAD(P)H:quinone oxidoreductase, cytochrome P450 2E1 or alcohol dehydrogenase genotypes in susceptibility to colorectal cancer.
16029924 2006 The association between microsomal epoxide hydrolase genotypes and esophageal squamous-cell-carcinoma in Taiwan: interaction between areca chewing and smoking.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
16005144 2006 EPHX1 gene polymorphisms and individual susceptibility to lung cancer.
15938845 2005 [Association of metabolic and DNA repair enzyme gene polymorphisms and DNA damage in coke-oven workers].
15928955 2005 Genetic polymorphisms in the cytochromes P-450 (1A1, 2E1), microsomal epoxide hydrolase and glutathione S-transferase M1, T1, and P1 genes, and their relationship with chronic bronchitis and relapsing pneumonia in children.
15924351 2005 Epoxide hydrolase and CYP2C9 polymorphisms, cigarette smoking, and risk of colorectal carcinoma in the Nurses' Health Study and the Physicians' Health Study.
15901990 2005 Genetic analysis of microsomal epoxide hydrolase gene and its association with lung cancer risk.
15900282 2005 Common genetic variants of microsomal epoxide hydrolase affect warfarin dose requirements beyond the effect of cytochrome P450 2C9.
15894702 2005 Microsomal epoxide hydrolase polymorphisms are not associated with colon cancer risk.
15838728 Genetic variants of TP53 and EPHX1 in Leber's hereditary optic neuropathy and their relationship to age at onset.
15817713 2005 Attempted replication of reported chronic obstructive pulmonary disease candidate gene associations.
15774926 2005 Association study of detoxification genes in age related macular degeneration.
15746160 2005 Constitutional short telomeres are strong genetic susceptibility markers for bladder cancer.
15734960 2005 Hepatocellular carcinoma and polymorphisms in carcinogen-metabolizing and DNA repair enzymes in a population with aflatoxin exposure and hepatitis B virus endemicity.
15719050 2005 [Associations of genetic polymorphisms in the EPHX1 gene and the GSTT1 gene with low birth weight in neonates].
15716486 2005 Variability in human sensitivity to 1,3-butadiene: influence of polymorphisms in the 5'-flanking region of the microsomal epoxide hydrolase gene (EPHX1).
15714076 2005 CYP2C9 gene variants, drug dose, and bleeding risk in warfarin-treated patients: a HuGEnet systematic review and meta-analysis.
15702235 2005 Polymorphisms for microsomal epoxide hydrolase and genetic susceptibility to COPD.
15692831 2005 Haplotype structures of EPHX1 and their effects on the metabolism of carbamazepine-10,11-epoxide in Japanese epileptic patients.
15668489 2005 Microsomal epoxide hydrolase polymorphisms and risk for advanced colorectal adenoma.
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15640939 2004 Combined analysis of polymorphisms in glutathione S-transferase M1 and microsomal epoxide hydrolase in lung cancer patients.
15640066 2004 [Studies of the genes related to lung cancer susceptibility in Nanjing Han population, China].
15618730 2003 Five novel single nucleotide polymorphisms in the EPHX1 gene encoding microsomal epoxide hydrolase.
15582499 2004 Low-activity haplotype of the microsomal epoxide hydrolase gene is protective against placental abruption.
15536330 2004 CYP2E1 polymorphism, cigarette smoking, p53 expression, and survival in non-small cell lung cancer: a long term follow-up study.
15535985 2004 Functional analysis of human microsomal epoxide hydrolase genetic variants.
15531751 2005 Microsomal epoxide hydrolase, endotoxin, and lung function decline in cotton textile workers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488121 2004 The Tyr113His polymorphism in exon 3 of the microsomal epoxide hydrolase gene is a risk factor for perinatal mortality.
15466980 2004 Effects of genetic polymorphisms of metabolic enzymes on cytokinesis-block micronucleus in peripheral blood lymphocyte among coke-oven workers.
15465926 2005 Alternative promoters determine tissue-specific expression profiles of the human microsomal epoxide hydrolase gene (EPHX1).
15355699 2004 [Effect of genetic polymorphisms of microsomal epoxide hydrolase on urinary 1-hydroxypyrene levels in coke oven workers].
15352038 2004 Vegetable, fruit and meat consumption and potential risk modifying genes in relation to colorectal cancer.
15298956 2004 Benzo(a)pyrene diolepoxide (BPDE)-DNA adduct levels in leukocytes of smokers in relation to polymorphism of CYP1A1, GSTM1, GSTP1, GSTT1, and mEH.
15280903 2004 Breast cancer: role of polymorphisms in biotransformation enzymes.
15256148 2004 [Relationship of genetic polymorphism of microsomal epoxide hydrolase with susceptibility of chronic benzene poisoning].
15199549 2004 Polymorphisms in DNA repair genes, chromosome aberrations, and lung cancer.
15150264 2004 CCAAT/enhancer-binding protein alpha (C/EBPalpha) activates transcription of the human microsomal epoxide hydrolase gene (EPHX1) through the interaction with DNA-bound NF-Y.
15138035 2004 Life style, environmental and genetic susceptibility to cervical cancer.
15061915 2004 [A study on the inherited susceptibility of chromosomal damage in peripheral blood lymphocytes among coke oven workers].
15036125 2004 Influence of GSTT1, mEH, CYP2E1 and RAD51 polymorphisms on diepoxybutane-induced SCE frequency in cultured human lymphocytes.
14988221 2004 Epoxide hydrolase polymorphisms, cigarette smoking and risk of colorectal adenoma in the Nurses' Health Study and the Health Professionals Follow-up Study.
14984931 2004 Regulation of human microsomal epoxide hydrolase gene (EPHX1) expression by the transcription factor GATA-4.
14751678 2004 Occupational exposure to styrene: modulation of cytogenetic damage and levels of urinary metabolites of styrene by polymorphisms in genes CYP2E1, EPHX1, GSTM1, GSTT1 and GSTP1.
14719475 2003 Analysis of polymorphic patterns in candidate genes in Israeli patients with prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681495 2004 Glutathione S transferase theta 1 gene (GSTT1) null genotype is associated with an increased risk for acquired aplastic anemia in children.
14669306 2003 Epoxide hydrolase Tyr113His polymorphism is not associated with susceptibility to esophageal squamous cell carcinoma in population of North China.
14642084 2003 [Association between polymorphisms in the microsomal epoxide hydrolase (mEH) gene and chronic obstructive pulmonary disease].
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
12935919 2003 Effect of epoxide hydrolase polymorphisms on chromosome aberrations and risk for lung cancer.
12915882 2003 Association of microsomal epoxide hydrolase polymorphisms and lung cancer risk.
12878321 2003 Inhibition of human m-epoxide hydrolase gene expression in a case of hypercholanemia.
12854128 2003 CYP1A1, GSTs and mEH polymorphisms and susceptibility to esophageal carcinoma: study of population from a high- incidence area in north China.
12798882 2003 Two exonic single nucleotide polymorphisms in the microsomal epoxide hydrolase gene are associated with polycystic ovary syndrome.
12760253 2003 [Analysis of the polymorphic alleles of genes encoding phase 1 and phase 2 detoxication enzymes in patients with endometriosis].
12747973 2003 Epoxide hydrolase genotype and orolaryngeal cancer risk: interaction with GSTM1 genotype.
12717779 2003 Genetic polymorphism of drug-metabolizing enzymes and styrene-induced DNA damage.
12670526 2003 Associations between genetic polymorphisms of Phase I and II metabolizing enzymes, p53 and susceptibility to esophageal adenocarcinoma.
12631667 2003 Genetic polymorphisms in biotransformation enzymes in Crohn's disease: association with microsomal epoxide hydrolase.
12605384 2003 Variability in human sensitivity to 1,3-butadiene: Influence of the allelic variants of the microsomal epoxide hydrolase gene.
12579334 2003 Genetic susceptibility for emphysematous changes of the lung in Japanese.
12552594 2003 Polymorphisms for chemical metabolizing genes and risk for cervical neoplasia.
12496064 2002 Microsomal epoxide hydrolase variants are not associated with risk of breast cancer.
12491039 2003 Association between head and neck cancer and microsomal epoxide hydrolase genotypes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419832 2002 A pharmacogenetic study to investigate the role of dietary carcinogens in the etiology of colorectal cancer.
12397416 2002 Genetic polymorphisms of biotransformation enzymes in patients with Hodgkin's and non-Hodgkin's lymphomas.
12376511 2002 Influence of metabolic genotypes on biomarkers of exposure to 1,3-butadiene in humans.
12359356 2002 Microsomal epoxide hydrolase and glutathione S-transferase polymorphisms in relation to laryngeal carcinoma risk.
12234472 2002 Detection of polymorphisms at exons 3 (Tyr113-->His) and 4 (His139-->Arg) of the microsomal epoxide hydrolase gene using fluorescence PCR method combined with melting curves analysis.
12173035 2002 Two exonic single nucleotide polymorphisms in the microsomal epoxide hydrolase gene are jointly associated with preeclampsia.
12160895 2002 Effects on sister chromatid exchange frequency of polymorphisms in DNA repair gene XRCC1 in smokers.
12141066 Microsomal epoxide hydrolase polymorphisms and lung cancer risk: a quantitative review.
12121132 Identification of two tamoxifen target proteins by photolabeling with 4-(2-morpholinoethoxy)benzophenone.
12029283 2002 Polymorphisms of xenobiotic metabolizing genes in oropharyngeal carcinoma.
11967624 2002 Susceptibility factors and DNA adducts in peripheral blood mononuclear cells of aluminium smelter workers exposed to polycyclic aromatic hydrocarbons.
11940289 2002 [Microsomal epoxide hydrolase gene polymorphism and susceptibility to chronic obstructive pulmonary disease in Han nationality of North China].
11859435 The effect of relevant genotypes on PAH exposure-related biomarkers.
11849215 2002 Genetic polymorphisms in microsomal epoxide hydrolase and susceptibility to adult acute myeloid leukaemia with defined cytogenetic abnormalities.
11813302 2002 Microsomal epoxide hydrolase polymorphisms and lung cancer risk in non-Hispanic whites.
11758809 2001 Distribution of microsomal epoxide hydrolase in humans: an immunohistochemical study in normal tissues, and benign and malignant tumours.
11751440 2001 Metabolic gene polymorphism frequencies in control populations.
11692079 2001 Genetic polymorphisms of microsomal and soluble epoxide hydrolase and the risk of Parkinson's disease.
11597790 2001 Lung cancer susceptibility in relation to combined polymorphisms of microsomal epoxide hydrolase and glutathione S-transferase P1.
11551408 Genetic polymorphisms of NAD(P)H quinone oxidoreductase, CYP1A1 and microsomal epoxide hydrolase and lung cancer risk in Nanjing, China.
11535253 2001 Association between genetic polymorphisms and biomarkers in styrene-exposed workers.
11520401 2001 Molecular epidemiology of preterm delivery: methodology and challenges.
11489754 2001 Epoxide hydrolase Tyr113His polymorphism is associated with elevated risk of colorectal polyps in the presence of smoking and high meat intake.
11480169 2001 [Analysis of association between gene polymorphisms of microsomal epoxide hydrolase (EPHX1) and infant birthweight].
11471167 2001 Analysis of the EPHX1 113 polymorphism and GSTM1 homozygous null polymorphism and oral clefting associated with maternal smoking.
11440964 2001 Role of genetic polymorphism of glutathione-S-transferase T1 and microsomal epoxide hydrolase in aflatoxin-associated hepatocellular carcinoma.
11406608 2001 Genetic polymorphisms of biotransformation enzymes in patients with Hodgkin's and non-Hodgkin's lymphomas.
11375900 2001 The association of microsomal epoxide hydrolase polymorphisms and lung cancer risk in African-Americans and Mexican-Americans.
11283205 2001 A polymorphism in the gene for microsomal epoxide hydrolase is associated with pre-eclampsia.
11255266 2001 The microsomal epoxide hydrolase Tyr113His polymorphism: association with risk of ovarian cancer.
11191882 2000 Genetic polymorphisms of biotransformation enzymes: allele frequencies in the population of the Czech Republic.
11124296 2000 Genetic association of manganese superoxide dismutase with exudative age-related macular degeneration.
11058921 2000 Identification of 6 new polymorphisms, g.11177G>A, g.14622C>T (R49C), g.17540T>C, g.17639T>C, g.30929T>C, g.31074G>A (R454Q), in the human microsomal epoxide hydrolase gene (EPHX1) in a French population.
10965908 2000 Epoxide hydrolase affects estrogen production in the human ovary.
10828267 2000 Fingerprinting of cytochrome P450 and microsomal epoxide hydrolase gene expression in human blood cells.
10066160 1999 Genetic polymorphisms of human N-acetyltransferase, cytochrome P450, glutathione-S-transferase, and epoxide hydrolase enzymes: relevance to xenobiotic metabolism and toxicity.
9925921 1998 Assignment1 of microsomal epoxide hydrolase (EPHX1) to human chromosome 1q42.1 by in situ hybridization.
9255563 1997 The role of human glutathione transferases and epoxide hydrolases in the metabolism of xenobiotics.
7920694 1994 Characterization of the microsomal epoxide hydrolase gene in patients with anticonvulsant adverse drug reactions.
7892276 1995 Susceptibility to hepatocellular carcinoma is associated with genetic variation in the enzymatic detoxification of aflatoxin B1.
7835893 1994 The human microsomal epoxide hydrolase gene (EPHX1): complete nucleotide sequence and structural characterization.
7516776 1994 Human microsomal epoxide hydrolase: genetic polymorphism and functional expression in vitro of amino acid variants.
3502697 1987 Nucleotide and deduced amino acid sequence of human liver microsomal epoxide hydrolase.
2891713 1988 Human microsomal xenobiotic epoxide hydrolase. Complementary DNA sequence, complementary DNA-directed expression in COS-1 cells, and chromosomal localization.
2864485 1985 Genetic predisposition to phenytoin-induced birth defects.
2758034 1989 Xenobiotic microsomal epoxide hydrolase: 5' sequence of the human gene.