Property Summary

NCBI Gene PubMed Count 50
PubMed Score 32.30
PubTator Score 44.34

Knowledge Summary

Patent (48,807)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma -2.100 1.5e-20
ependymoma -2.700 8.3e-14
oligodendroglioma -2.200 1.1e-17
psoriasis -1.300 1.2e-07
cutaneous lupus erythematosus -1.900 2.8e-02
glioblastoma -2.900 2.0e-06
osteosarcoma -2.412 4.6e-08
sonic hedgehog group medulloblastoma -2.500 2.8e-05
atypical teratoid / rhabdoid tumor -3.200 1.2e-05
medulloblastoma, large-cell -1.900 3.6e-02
primitive neuroectodermal tumor -3.600 6.5e-08
pediatric high grade glioma -2.600 1.6e-06
pilocytic astrocytoma -3.500 1.5e-11
non primary Sjogren syndrome sicca 1.100 1.6e-02
subependymal giant cell astrocytoma -2.102 4.3e-02
ovarian cancer -1.800 1.2e-11
pituitary cancer 2.500 3.0e-05

Gene RIF (25)

PMID Text
26468391 EphB6 is a new biomarker for distinguishing high- and low-grade ovarian serous carcinoma, and may be a potential prognostic marker in ovarian serous carcinomas.
25331796 Studies clearly demonstrate an inverse relationship between the levels of phospho-ERK and the abundance of cadherin 17, beta-catenin and phospho-GSK3beta in EPHB6-expressing MDA-MB-231 cells.
25239188 These findings implicate EphB6 as a negative regulator of EphA2 oncogenic signaling.
25152371 EphB6 also interacts with the Hsp90 chaperone.
24912672 Results suggest that erythropoietin-producing hepatocyte (Eph) receptor B6 (EphB6) may represent a useful tissue biomarker for the prediction of survival rate in colorectal cancers (CRCs).
24836890 We demonstrate that EphB6 reexpression forces metastatic melanoma cells to deviate from the canonical migration pattern observed in the chick embryo transplant model
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with EPHB6
22039307 Our work shows that EphB3 is consistently expressed by malignant T lymphocytes, most frequently in combination with EphB6, and that stimulation with their common ligands strongly suppresses Fas-induced apoptosis in these cells.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21811619 The alterations in miRNAs and their target mRNAs also suggest indirect involvement of EphB6 in PI3K/Akt/mTOR pathways.
21737611 results indicate that tumor invasiveness-suppressing activity of EPHB6 is mediated by its ability to sequester other kinase-sufficient and oncogenic EPH receptors
21351276 Nonsynonymous variants of EPHB6 is associated with familial colorectal cancer.
20952760 expression of more than 70 proteins was altered in EphB6-transfected MDA-MB-231 cells; proteins are involved in glycolysis, cell cycle regulation, tumor suppression, cell proliferation, mitochondrial metabolism, mRNA splicing, DNA replication and repair
20181626 The loss of EPHB6 expression in more aggressive breast carcinoma cell lines is regulated in a methylation-dependent manner. The EPHB6 methylation-specific PCR has clinical implications for the prognosis and/or diagnosis of breast and other cancer types
20086179 Findings suggest a new role for EphB6 in suppressing cancer invasiveness and cell attachment through c-Cbl-dependent signaling.
19513565 The kinase defective EPHB6 receptor tyrosine kinase activates MAP kinase signaling in lung adenocarcinoma.
19234485 EphB6 receptor significantly alters invasiveness and other phenotypic characteristics of human breast carcinoma cells.
18819711 CLL B-cells showed a more heterogeneous Eph/EFN profile, specially EFNA4, EphB6 and EphA10. EphB6 and EFNA4 were further related with the clinical course of CLL.
18754880 the two peptides derived from EphB6v might be appropriate targets for peptide-based specific immunotherapy for HLA-A2(+) patients with various cancers
16364251 The potential significance of EphB6 to serve as a diagnostic and prognostic indicator is discussed.
15955811 EphB6 can both positively and negatively regulate cell adhesion and migration
14612926 lower EphB6 expression has a role in melanoma progression to metastatic disease
12517763 EphB6 may play an important role in regulating thymocyte differentiation and modulating responses of mature T cells.
12393850 interaction between EphB6 and its ligands facilitates T cell responses to antigen
11466354 Cross-linking of EphB6 alters profiles of lymphokine secretion, inhibits proliferation, induces Fas-mediated apoptosis of Jurkat leukemic T cells, and transduces signals into the cells via proteins it associates with.

AA Sequence

MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTR      1 - 70
TFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDS     71 - 140
PDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFY    141 - 210
VAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGS    211 - 280
PPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPC    281 - 350
LEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG    351 - 420
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSA    421 - 490
VPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQV    491 - 560
RARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTE    561 - 630
QLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVA    631 - 700
IQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSL    701 - 770
QLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT    771 - 840
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQ    841 - 910
LVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDV    911 - 980
AQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV                                 981 - 1021
//

Text Mined References (53)

PMID Year Title
26468391 2016 Expression of EphB6 in ovarian serous carcinoma is associated with grade, TNM stage and survival.
25416956 2014 A proteome-scale map of the human interactome network.
25331796 Modulation of liver-intestine cadherin (Cadherin 17) expression, ERK phosphorylation and WNT signaling in EPHB6 receptor-expressing MDA-MB-231 cells.
25239188 2014 EphB6 promotes anoikis by modulating EphA2 signaling.
25152371 2014 Ligand stimulation induces clathrin- and Rab5-dependent downregulation of the kinase-dead EphB6 receptor preceded by the disruption of EphB6-Hsp90 interaction.
24912672 2014 Loss of EphB6 protein expression in human colorectal cancer correlates with poor prognosis.
24836890 2014 Dynamic interactions between cancer cells and the embryonic microenvironment regulate cell invasion and reveal EphB6 as a metastasis suppressor.
23226491 2012 Mutations of the EPHB6 receptor tyrosine kinase induce a pro-metastatic phenotype in non-small cell lung cancer.
22223652 2012 Receptor tyrosine kinase Ephb6 regulates vascular smooth muscle contractility and modulates blood pressure in concert with sex hormones.
22039307 2011 EphB receptors trigger Akt activation and suppress Fas receptor-induced apoptosis in malignant T lymphocytes.
21935409 2011 Eph/ephrin profiling in human breast cancer reveals significant associations between expression level and clinical outcome.
21811619 2011 EphB6 receptor modulates micro RNA profile of breast carcinoma cells.
21737611 A paradigm shift in EPH receptor interaction: biological relevance of EPHB6 interaction with EPHA2 and EPHB2 in breast carcinoma cell lines.
21455264 2011 Dancing with the dead: Eph receptors and their kinase-null partners.
21351276 2010 Somatic mutations and germline sequence variants in patients with familial colorectal cancer.
20952760 Tyrosine kinase-deficient EphB6 receptor-dependent alterations in proteomic profiles of invasive breast carcinoma cells as determined by difference gel electrophoresis.
20371680 2010 The EPHB6 receptor tyrosine kinase is a metastasis suppressor that is frequently silenced by promoter DNA hypermethylation in non-small cell lung cancer.
20181626 DNA-based assay for EPHB6 expression in breast carcinoma cells as a potential diagnostic test for detecting tumor cells in circulation.
20086179 2010 The EphB6 receptor cooperates with c-Cbl to regulate the behavior of breast cancer cells.
19513565 2009 The kinase defective EPHB6 receptor tyrosine kinase activates MAP kinase signaling in lung adenocarcinoma.
19234485 2009 EphB6 receptor significantly alters invasiveness and other phenotypic characteristics of human breast carcinoma cells.
18819711 2009 Expression profile of Eph receptors and ephrin ligands in healthy human B lymphocytes and chronic lymphocytic leukemia B-cells.
18754880 2008 Erythropoietin-producing hepatocyte B6 variant-derived peptides with the ability to induce glioma-reactive cytotoxic T lymphocytes in human leukocyte antigen-A2+ glioma patients.
18425388 2008 Identification of EphB6 variant-derived epitope peptides recognized by cytotoxic T-lymphocytes from HLA-A24+ malignant glioma patients.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16364251 2006 Transcriptional silencing of EphB6 receptor tyrosine kinase in invasive breast carcinoma cells and detection of methylated promoter by methylation specific PCR.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15955811 2005 Biphasic functions of the kinase-defective Ephb6 receptor in cell adhesion and migration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14612926 2003 Loss of EphB6 expression in metastatic melanoma.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12517763 2003 The EphB6 receptor inhibits JNK activation in T lymphocytes and modulates T cell receptor-mediated responses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393850 2002 EphB6 crosslinking results in costimulation of T cells.
11713248 2002 The kinase-null EphB6 receptor undergoes transphosphorylation in a complex with EphB1.
11466354 2001 Cross-linking of EphB6 resulting in signal transduction and apoptosis in Jurkat cells.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10984508 2000 Implications of EPHB6, EFNB2, and EFNB3 expressions in human neuroblastoma.
10831073 2000 T-cell-specific expression of kinase-defective Eph-family receptor protein, EphB6 in normal as well as transformed hematopoietic cells.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10648835 2000 Ephrin-B2 is a candidate ligand for the Eph receptor, EphB6.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9707552 1998 PDZ-domain-mediated interaction of the Eph-related receptor tyrosine kinase EphB3 and the ras-binding protein AF6 depends on the kinase activity of the receptor.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9207182 1997 Expression of a kinase-defective Eph-like receptor in the normal human brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.