Property Summary

Ligand Count 75
NCBI Gene PubMed Count 120
PubMed Score 206.32
PubTator Score 156.00

Knowledge Summary

Patent (57,679)

Expression

  Differential Expression (8)

Disease log2 FC p
Amyotrophic lateral sclerosis -1.043 1.2e-04
atypical teratoid / rhabdoid tumor 1.400 8.9e-07
intraductal papillary-mucinous carcinoma... 1.400 3.5e-04
juvenile dermatomyositis -1.143 2.4e-09
lung carcinoma -1.100 2.0e-12
ovarian cancer -1.100 3.2e-06
psoriasis -1.800 8.0e-05
sonic hedgehog group medulloblastoma 1.200 1.1e-04

PDB (18)

Gene RIF (95)

AA Sequence

MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA      1 - 70
HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT     71 - 140
VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET    141 - 210
VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS    211 - 280
GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG    281 - 350
GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV    351 - 420
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN    421 - 490
RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV    491 - 560
LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC    561 - 630
RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA    631 - 700
LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS    701 - 770
DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP    771 - 840
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG    841 - 910
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT    911 - 980
GGPAPQY                                                                   981 - 987
//

Text Mined References (129)

PMID Year Title