Property Summary

NCBI Gene PubMed Count 107
PubMed Score 184.71
PubTator Score 156.00

Knowledge Summary

Patent (57,679)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.800 8.0e-05
atypical teratoid / rhabdoid tumor 1.400 8.9e-07
juvenile dermatomyositis -1.143 2.4e-09
Amyotrophic Lateral Sclerosis -1.043 1.2e-04
intraductal papillary-mucinous carcinoma... 1.400 3.5e-04
sonic hedgehog group medulloblastoma 1.200 1.1e-04
lung carcinoma -1.100 2.0e-12
ovarian cancer -1.100 3.2e-06

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720 screening 143 / 0 / 96746 Primary biochemical high-throughput screening assay for antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide probe
835 confirmatory 5 / 0 / 123 Dose-response biochemical assay for antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide
1669 summary 0 / 0 / 0 Summary of the probe development efforts to identify antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (82)

PMID Text
26481148 Results indicate EphB4 receptor as a critical mediator of erythropoietin-induced tumor progression.
26414866 EPHB4 oncogenomic network provides a molecular basis for its role in tumor progression and points to EPHB4 as a potential tumor aggressiveness biomarker and drug target in gastroesophageal cancers
26191333 Suggest role for EphB4/IGF1R signaling in regulation proliferation/migration of breast cancer cells.
26132739 CTLA4 modification maintains EphB4 expression in mesenchymal stem cells under immune activation conditions.
26073592 Novel EPHB4 receptor tyrosine kinase mutations have been found in lung cancer patients.
26033476 EphB4 facilitates stromal-mediated support of hematopoiesis in hematopoietic stem cells.
25886373 EphB4 regulates integrin Beta8 expression and integrin Beta8 plays a role in prostate cancer cells.
25724901 EphB4 contains two nuclear localization signal sequences and localises to the nucleus.
25581780 N-(2,4)-dinitrophenyl-L-arginine Interacts with EphB4 and Functions as an EphB4 Kinase Modulator.
25446283 Stimulation of Eph-B4 function may be a candidate strategy for translation to human clinical trials designed to inhibit venous neointimal hyperplasia.
25391996 EPHB4 expression is associate with progression of HNSCC from normal tissue to dysplasia and to cancer.
25274141 Silencing of EPHB4 significantly reduced the transmigration of synovial sarcoma cells.
25191151 Venous Eph-B4 expression diminished (p = .002), Ephrin-B2 expression was not induced (p = .268), and expression of osteopontin (p = .002) was increased with exposure to arterial magnitudes of shear stress.
25148033 loss of EphB2 and gain of EphB4 expression represents an inflection point in the development, growth and possibly progression of TCC.
25051915 The recombinant plasmid can inhibit the expression of EphB4 mRNA and protein in PANC-1 cells, as well as cell growth and migration.
24771266 our study revealed the important function and regulation of EphB4 in the progression of ESCC and suggested EphB4 as a novel target for the treatment of ESCC.
24764074 Decreased EphB4 expression is associated with acute myeloid leukemia.
24733895 These results are the first to identify EphB4 and its cross-talk with PDGFRbeta as unexpected vital determinants of tumor cell survival in alveolar rhabdomyosarcoma.
24677421 Comparative crystalisation analysis of the human EphB family kinases has yielded new crystal forms of the human EphB2 and EphB4 catalytic domains.
24634162 These genes may be potential biomarkers for identification of subclinical lymph node involvement in papillary thyroid carcinoma (PTC)
24517927 EphB4 and ephrin B2 play important roles in neovascularization and arteriovenous differentiation/plasticity.
24427781 EphB4 activation can differentially inhibit breast cancer cells at post confluent state.
24121831 High EphB4 expression is associated with glioma.
23844053 The EphB4 receptor tyrosine kinase promotes lung cancer growth.
23725356 Our data suggests EphB4 as an upstream regulator of ER-alpha in human breast cancer cells by modulating ER-alpha transcription. The results also suggest Akt as a relevant downstream signaling molecule in this novel EphB4-ER-alpha pathway.
23721559 EphB4 was overexpressed in 72% of mesothelioma tissues
23579861 Compared gene expression profiles in CRC patients treated with bevacizumab who responded to the treatment with those that did not respond. Found EPHB4 expression significantly increased in nonresponders and high levels associated with decreased survival.
23314808 molecular classification of breast cancer is based upon the expression of ESR, PGR and HER2; the expression of EPOR, membrane receptor GPER and EPHB4 may be considered as an additional classification factor in breast cancer
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
23211050 HAb47-Cy5.5 successfully imaged the decreased EphB4 expression.
23138393 expression of EphB4 was significantly upregulated in clinical glioma samples; overexpression of EphB4 in glioma cell lines accelerated cell growth and tumorigenesis; downregulation of EphB4 inhibited cell growth
23100466 EphB4 is robustly expressed and potentially serves as a novel biomarker for targeted therapy in esophageal cancers
23079712 EphB4 receptor expresion is correlated to the initiation, progression and tumor angiogenesis.
23063927 verify amplification and/or deletion in the ACHE, BCHE, EPHB4 and MME genes in 32 samples of sporadic breast cancer
22684742 EphB4 protein expression is significantly increased in non-small- cell lung cancer and corresponds to progression and severity of the disease.
22684558 levels of EphB4, mTOR and Akt were distinctly lower than those in other groups. It was concluded that suppression of EphB4 may inhibit the growth of ovarian cancer cells by downregulation of the PI3K/Akt/mTOR pathway.
22528941 EphB4 plays an important role in the progression of papillary thyroid carcinoma by stimulating cell migration and EphB4 might be a potential therapeutic target in papillary thyroid carcinoma.
22374425 Data indicated for the first time that EphrinB2 and EphB4 expressions increase according to the histopathological grade and KPS score of glioma, and their expression levels are related to the progression-free survival of glioblastoma patients.
22024229 EphB4/EphrinB2 expression has closed related to gennesis and progression of hepatoblastoma.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21575518 The expressions of ephrinB2 and EphB4 were significantly higher in NSCLC tissue than in control tissues, and were positively correlated with lymphatic metastasis.
21047731 EphB4/ephrinB2 interactions between tumor cells and endothelial cells identify a mechanism for site-specific metastatic dissemination of tumor cells.
20686847 Ephb4 was over-expressed and localized to the cytoplasm of gastric cancer cells. Moreover, Ephb4 protein was observed as being significantly related to tumor size and regional lymph nodes category.
20133814 MAb47 targets fibronectin-like domain 2 of both human and murine EphB4 and does not alter EphB4 receptor levels, but inhibits angiogenesis and growth of both EphB4-positive and EphB4-negative tumors in a mouse s.c. xenograft model
20061560 EPHB4 can function as a tumor suppressor in acute lymphoblastic leukemia
20031623 EPHB4 gene polymorphisms are associated with the risk of intracranial hemorrhage in patients with brain arteriovenous malformations.
20031623 Observational study of gene-disease association. (HuGE Navigator)
20002159 EphB4 mediates a new mechanism of imatinib resistance that is independent of BCR-ABL and dependent on the RAS/MAPK pathway.
19664212 Our study is the first to provide data on the presence and role of ephrin B2/EphB4 receptors in human chondrocytes/cartilage
19597185 the ephrinB2/EphB4 axis is dysregulated in multiple myeloma, and its activation by EphB4-Fc inhibits myeloma growth and bone disease
19552627 The findings demonstrate that EphB4 can affect cancer cell behaviour in an ephrin-independent manner.
19366806 EphB4 is preferentially induced in colorectal cancer, in contrast to EphB2, whereby tumor cells acquire a survival advantage.
19356789 Localization of EphB4 is dominantly in the cancer cells of uterine cervical cancers of all cases given.
19272799 High EphB4 is associated with malignant urogenital tissue.
19035475 EphB4 receptor activation by ephrin B2 in osteoarthritis subchondral bone could affect abnormal metabolism in this tissue by inhibiting resorption factors and their activities
18957513 EphBR-ephrinB interactions lead to monocyte adhesion and transmigration through the vascular endothelium.
18340006 EphB4 is a critical component of the CYP2C9- and 11,12-EET-activated signaling cascade that promotes angiogenesis in vitro as well as in vivo.
18231102 Overexpression of EphB4 is associated with tumour advancement of ovarian cancers
17611172 EphB4 expression was found in 44 (72.1%) out of 61 cancer tissues analysed.
17510705 activation of EphB4 enhances proangiogenic capacity through induction of PSGL-1 expression and adhesion to E selectin and P selectin
17353927 Overexpression of EphB4 is associated with ovarian cancer
17234965 Notch signaling by induction of Dll1 was necessary & sufficient to induce EphB4-dependent branching morphogenesis in human arterial EC.
17196593 demonstrates that Eph B4 and Ephrin B2 interaction may play an important role in the oncogenesis and angiogenesis of cervical carcinomas
16982731 Study provides evidence showing that promoter methylation regulates EPHB4 transcription and that EPHB4 can regulate the long-term clonogenic potential of colorectal tumor cells, revealing EPHB4 as a potential tumor suppressor gene in colorectal cancer.
16867992 The results provide critical information on the EphB4*ephrinB2 protein interfaces and their mode of interaction, which will facilitate development of small molecule compounds inhibiting the EphB4*ephrinB2 interaction as novel cancer therapeutics.
16840724 novel link between EphB forward signaling and SDF-1-induced signaling demonstrates a mechanism for cooperative regulation of endothelial cell movement.
16615113 Overexpression of EphB4 is associated with squamous cell carcinoma of the head and neck
16424904 EphB4 acts as a negative regulator of blood vessel branching and vascular network formation, switching the vascularization program from sprouting angiogenesis to circumferential vessel growth.
16343615 EphB4 and ephrin-B2 are instrumental in the establishment of a functional placental structure and of the utero-placental circulation.
16205642 EphB4 knockdown in an in vivo murine tumor xenograft model led to a nearly 80% reduction in tumor volume associated with reduced tumor proliferation, increased apoptosis and reduced tumor microvasculature
16171530 EphB4 is expressed in prostate cancer cell lines with increased expression in human prostate cancers when compared with matched normal tissue
16107476 EPHB4 regulates chemokine-evoked trophoblast responses: a mechanism for incorporating the human placenta into the maternal circulation.
15930280 EphB4 protein levels are high in the PC3 prostate cancer cell line and several folds higher in a metastatic clone of PC3 (PC3M) where overexpression was accompanied by EphB4 gene amplification.
15722342 analysis of EphB1, EphB2, and EphB4-binding peptides interaction with antagonists with ephrin-like affinity
15358160 These results suggest that activation of EphB4 participates in adhesive but not repulsive signals independently of its tyrosine kinase activity in hematopoietic cells.
15193868 EphB4 and ephrin-B2 molecules, which have specific expression patterns during artery and vein development, respectively, were expressed in the placenta
15126321 in hyperinflammatory lesions, ephrinB2 was predominantly expressed in macrophage-like cells and EphB4 in small venules; syntenin and syndecan-1 were up-regulated in EphB4-positive endothelial cells after stimulation with preclustered ephrinB2
14764452 HoxA9 binds to the EphB4 promoter & stimulates its expression resulting in an increase of endothelial cell migration and tube forming activity. Thus, modulation of EphB4 expression may contribute to the proangiogenic effect of HoxA9 in endothelial cells.
12734395 EphB4 is pro-adhesive and stimulates endothelial cell migration and sprouting angiogenesis. EphrinB2-mediated repulsive signals are transduced by EphB4.
12235151 Eph B4 stimulates migration and proliferation and may play a role in angiogenesis
12051776 role of EphB4 receptor in erythropoiesis
11929761 accelerates differentiation of select human hematopoietic cells

AA Sequence

MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA      1 - 70
HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT     71 - 140
VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET    141 - 210
VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS    211 - 280
GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG    281 - 350
GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV    351 - 420
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN    421 - 490
RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV    491 - 560
LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC    561 - 630
RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA    631 - 700
LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS    701 - 770
DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP    771 - 840
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG    841 - 910
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT    911 - 980
GGPAPQY                                                                   981 - 987
//

Text Mined References (116)

PMID Year Title
26481148 2015 Erythropoietin Stimulates Tumor Growth via EphB4.
26414866 2016 Differential protein expression and oncogenic gene network link tyrosine kinase ephrin B4 receptor to aggressive gastric and gastroesophageal junction cancers.
26191333 2015 The role of EphB4 and IGF-IR expression in breast cancer cells.
26132739 2015 EphB4 Promotes Osteogenesis of CTLA4-Modified Bone Marrow-Derived Mesenchymal Stem Cells Through Cross Talk with Wnt Pathway in Xenotransplantation.
26073592 2015 Novel EPHB4 Receptor Tyrosine Kinase Mutations and Kinomic Pathway Analysis in Lung Cancer.
26033476 2015 EphB4 Expressing Stromal Cells Exhibit an Enhanced Capacity for Hematopoietic Stem Cell Maintenance.
25886373 2015 The tumour-promoting receptor tyrosine kinase, EphB4, regulates expression of integrin-?8 in prostate cancer cells.
25724901 2015 EphB4 localises to the nucleus of prostate cancer cells.
25581780 2015 N-(2,4)-dinitrophenyl-L-arginine Interacts with EphB4 and Functions as an EphB4 Kinase Modulator.
25446283 2016 Ephrin type-B receptor 4 activation reduces neointimal hyperplasia in human saphenous vein in vitro.
25391996 2014 Expression of the EPHB4 receptor tyrosine kinase in head and neck and renal malignancies--implications for solid tumors and potential for therapeutic inhibition.
25274141 2015 EPHB4 tyrosine-kinase receptor expression and biological significance in soft tissue sarcoma.
25191151 2014 Arterial shear stress reduces eph-b4 expression in adult human veins.
25148033 2014 The differential expression of EphB2 and EphB4 receptor kinases in normal bladder and in transitional cell carcinoma of the bladder.
25051915 2014 EphB4 regulates the growth and migration of pancreatic cancer cells.
24771266 2014 Down-regulation of EphB4 phosphorylation is necessary for esophageal squamous cell carcinoma tumorigenecity.
24764074 2014 Expression of Eph A4, Eph B2 and Eph B4 receptors in AML.
24733895 2014 PDGFR? reverses EphB4 signaling in alveolar rhabdomyosarcoma.
24677421 2014 Completing the structural family portrait of the human EphB tyrosine kinase domains.
24634162 2015 Overexpression of EphB4, EphrinB2, and epidermal growth factor receptor in papillary thyroid carcinoma: A pilot study.
24517927 2014 Ephrin B2 and EphB4 selectively mark arterial and venous vessels in cerebral arteriovenous malformation.
24427781 2013 EphB4 tyrosine kinase stimulation inhibits growth of MDA-MB-231 breast cancer cells in a dose and time dependent manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121831 2013 Ligand-dependent EphB1 signaling suppresses glioma invasion and correlates with patient survival.
23844053 2013 The EphB4 receptor tyrosine kinase promotes lung cancer growth: a potential novel therapeutic target.
23725356 2013 Eph receptor B4 is a regulator of estrogen receptor alpha in breast cancer cells.
23721559 2013 EphB4 as a therapeutic target in mesothelioma.
23579861 2013 Gene expression profiling identifies EPHB4 as a potential predictive biomarker in colorectal cancer patients treated with bevacizumab.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23314808 2013 Correlation between erythropoietin receptor(s) and estrogen and progesterone receptor expression in different breast cancer cell lines.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
23211050 2013 Targeting the EphB4 receptor for cancer diagnosis and therapy monitoring.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23138393 2013 EphB4 is overexpressed in gliomas and promotes the growth of glioma cells.
23100466 2013 Critical role for the receptor tyrosine kinase EPHB4 in esophageal cancers.
23079712 2013 Clinical implications of EphB4 receptor expression in pancreatic cancer.
23063927 2013 Copy number variation in ACHE/EPHB4 (7q22) and in BCHE/MME (3q26) genes in sporadic breast cancer.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22684742 2012 EphB4 gene polymorphism and protein expression in non-small-cell lung cancer.
22684558 2012 Suppression of EphB4 improves the inhibitory effect of mTOR shRNA on the biological behaviors of ovarian cancer cells by down-regulating Akt phosphorylation.
22528941 2012 EphB4 is overexpressed in papillary thyroid carcinoma and promotes the migration of papillary thyroid cancer cells.
22374425 2012 Expression of EphrinB2 and EphB4 in glioma tissues correlated to the progression of glioma and the prognosis of glioblastoma patients.
22024229 2012 Relationships among differentiation degree, contrast-enhanced ultrasound and the expression of Ephb4/Ephrinb2 in primary hepatocarcinoma.
21935409 2011 Eph/ephrin profiling in human breast cancer reveals significant associations between expression level and clinical outcome.
21575518 2011 [Relationship between multi-slice spiral CT pulmonary perfusion imaging and the expression of EphB4 and ephrinB2 in non-small cell lung cancer].
21269460 2011 Initial characterization of the human central proteome.
21047731 2010 EphB4 promotes site-specific metastatic tumor cell dissemination by interacting with endothelial cell-expressed ephrinB2.
20686847 2011 Over-expression of Ephb4 is associated with carcinogenesis of gastric cancer.
20133814 2010 Novel EphB4 monoclonal antibodies modulate angiogenesis and inhibit tumor growth.
20061560 2010 Aberrant DNA methylation and epigenetic inactivation of Eph receptor tyrosine kinases and ephrin ligands in acute lymphoblastic leukemia.
20031623 2009 EPHB4 gene polymorphisms and risk of intracranial hemorrhage in patients with brain arteriovenous malformations.
20002159 2010 BCR-ABL-independent and RAS / MAPK pathway-dependent form of imatinib resistance in Ph-positive acute lymphoblastic leukemia cell line with activation of EphB4.
19664212 2009 Treatment with ephrin B2 positively impacts the abnormal metabolism of human osteoarthritic chondrocytes.
19597185 2009 The ephrinB2/EphB4 axis is dysregulated in osteoprogenitors from myeloma patients and its activation affects myeloma bone disease and tumor growth.
19552627 2009 Ephrin-independent regulation of cell substrate adhesion by the EphB4 receptor.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366806 2009 Preferential induction of EphB4 over EphB2 and its implication in colorectal cancer progression.
19356789 2009 Coexpression of EphB4 and ephrinB2 in tumor advancement of uterine cervical cancers.
19272799 Distribution of EphB4 and EphrinB2 in normal and malignant urogenital tissue.
19035475 2008 Activation of the receptor EphB4 by its specific ligand ephrin B2 in human osteoarthritic subchondral bone osteoblasts.
18957513 2008 Involvement of endothelial ephrin-B2 in adhesion and transmigration of EphB-receptor-expressing monocytes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18340006 2008 Cytochrome P450 2C9-induced angiogenesis is dependent on EphB4.
18231102 2008 Coexpression of EphB4 and ephrinB2 in tumour advancement of ovarian cancers.
17611172 2007 Expression and prognostic significance of EFNB2 and EphB4 genes in patients with oesophageal squamous cell carcinoma.
17510705 2007 PSGL-1-mediated activation of EphB4 increases the proangiogenic potential of endothelial progenitor cells.
17353927 2007 The receptor tyrosine kinase EphB4 is overexpressed in ovarian cancer, provides survival signals and predicts poor outcome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17234965 2007 Notch ligand Delta-like 1 is essential for postnatal arteriogenesis.
17196593 2007 Expression of Eph B4 and Ephrin B2 in cervical cancer tissues and angiogenesis.
16982731 2006 EPHB4 and survival of colorectal cancer patients.
16867992 2006 Structural and biophysical characterization of the EphB4*ephrinB2 protein-protein interaction and receptor specificity.
16840724 2006 EphB2 and EphB4 receptors forward signaling promotes SDF-1-induced endothelial cell chemotaxis and branching remodeling.
16615113 2006 EphB4 provides survival advantage to squamous cell carcinoma of the head and neck.
16472751 2006 Structure and thermodynamic characterization of the EphB4/Ephrin-B2 antagonist peptide complex reveals the determinants for receptor specificity.
16424904 2006 EphB4 controls blood vascular morphogenesis during postnatal angiogenesis.
16343615 Differential expression of the receptor tyrosine kinase EphB4 and its ligand Ephrin-B2 during human placental development.
16322467 2006 The soluble extracellular domain of EphB4 (sEphB4) antagonizes EphB4-EphrinB2 interaction, modulates angiogenesis, and inhibits tumor growth.
16205642 2006 EphB4 receptor tyrosine kinase is expressed in bladder cancer and provides signals for cell survival.
16171530 2005 Investigation of the expression of the EphB4 receptor tyrosine kinase in prostate carcinoma.
16107476 2005 EPHB4 regulates chemokine-evoked trophoblast responses: a mechanism for incorporating the human placenta into the maternal circulation.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15930280 2005 EphB4 expression and biological significance in prostate cancer.
15722342 2005 EphB receptor-binding peptides identified by phage display enable design of an antagonist with ephrin-like affinity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358160 2004 Cell adhesion to ephrinb2 is induced by EphB4 independently of its kinase activity.
15193868 2004 Eph and ephrin expression in normal placental development and preeclampsia.
15126321 2004 Syndecan-1 up-regulated by ephrinB2/EphB4 plays dual roles in inflammatory angiogenesis.
14764452 2004 Homeobox A9 transcriptionally regulates the EphB4 receptor to modulate endothelial cell migration and tube formation.
12734395 2003 Forward EphB4 signaling in endothelial cells controls cellular repulsion and segregation from ephrinB2 positive cells.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235151 2002 Eph B4 receptor signaling mediates endothelial cell migration and proliferation via the phosphatidylinositol 3-kinase pathway.
12051776 2002 A role of EphB4 receptor and its ligand, ephrin-B2, in erythropoiesis.
11920461 2002 Coexpression of ephrin-Bs and their receptors in colon carcinoma.
11466354 2001 Cross-linking of EphB6 resulting in signal transduction and apoptosis in Jurkat cells.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11239002 2001 Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5.
11136979 2000 EphB receptors interact with NMDA receptors and regulate excitatory synapse formation.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10518221 1999 Symmetrical mutant phenotypes of the receptor EphB4 and its specific transmembrane ligand ephrin-B2 in cardiovascular development.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10037197 1999 Coexpression of transcripts encoding EPHB receptor protein tyrosine kinases and their ephrin-B ligands in human small cell lung carcinoma.
9718367 1998 Cell-type specific and estrogen dependent expression of the receptor tyrosine kinase EphB4 and its ligand ephrin-B2 during mammary gland morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8831703 1996 Expression of the receptor protein tyrosine kinase myk-1/htk in normal and malignant mammary epithelium.
8188704 1994 Cloning and characterization of HTK, a novel transmembrane tyrosine kinase of the EPH subfamily.
8152808 1994 Expression of two novel eph-related receptor protein tyrosine kinases in mammary gland development and carcinogenesis.