Property Summary

NCBI Gene PubMed Count 126
PubMed Score 472.15
PubTator Score 282.56

Knowledge Summary

Patent (187,111)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -4.100 6.6e-08
psoriasis 2.500 6.9e-140
cutaneous lupus erythematosus 1.700 8.8e-03
osteosarcoma 2.089 2.7e-03
group 3 medulloblastoma 2.600 2.5e-06
cystic fibrosis 1.891 4.0e-06
atypical teratoid / rhabdoid tumor 1.600 7.5e-04
glioblastoma 2.000 2.7e-06
medulloblastoma, large-cell 1.600 2.0e-04
primitive neuroectodermal tumor 2.100 4.3e-04
non-small cell lung cancer 1.118 1.7e-10
lung cancer 2.300 1.6e-04
colon cancer 1.800 6.5e-07
active Crohn's disease 1.063 2.7e-02
pediatric high grade glioma 1.400 1.4e-04

Protein-protein Interaction (9)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (70)

PMID Text
26407069 Expression of the Receptor Tyrosine Kinase EphB2 on Dendritic Cells Is Modulated by Toll-Like Receptor Ligation but Is Not Required for T Cell Activation
26195670 Myosin 1 functions as an effector of EphB2/ephrinB signaling, controls cell morphology, and thereby cell repulsion.
26119563 Data show that activation of EphB2 receptor kinase arrests tau protein hyperphosphorylation through phosphatidylinositol 3-kinase (PI3K)/Akt protein-mediated glycogen synthase kinase-3beta (GSK-3beta) inhibition.
25801123 EphB2 activation is required for ependymoma development as well as it inhibits differentiation and promotes proliferation of the transformed cell.
25643922 EphB2/ephrin-B1 were invoked in dental pulp stem cells with TNF-alpha treatment via the JNK-dependent pathway, but not NF-kB, p38 MAPK or MEK signalling.
25281742 Data indicate that the Eph tyrosine kinase receptors EphB2 and EphA2 are involved in factor/coagulation factor VIIa (TF/FVIIa) signaling.
25257729 The results show an intricate interplay between p53 and TGF-beta3 whereby p53 inhibits the TGF-beta3-induced expression of genes, e.g., EPHB2, to impede tumor cell invasion and migration
25148033 loss of EphB2 and gain of EphB4 expression represents an inflection point in the development, growth and possibly progression of TCC.
25012246 the upregulation of EphB2 receptors and its specific ligands leads to cholangiocarcinoma metastasis.
24803541 EphB2 was involved in human naive B cell activation through Src-p65 and Notch1 signaling pathways and could be regulated by miR-185.
24677421 Comparative crystalisation analysis of the human EphB family kinases has yielded new crystal forms of the human EphB2 and EphB4 catalytic domains.
24612059 Serrated colorectal carcinoma as proposed to arise from serrated adenoma is characterized by down regulation of EphB2.
24522257 knockdown impairs monocyte transmigration through the endothelium
24439224 EphB2 plays an important role in cervical cancer progression by orchestrating an epithelial-mesenchymal transition program through R-Ras activation.
24222164 Mutation of EPHB2 is frequent in colorectal tumors with microsatellite instability.
24211352 A mechanism involving a triple role for EphB2 in breast cancer progression, whereby it regulates apoptosis, autophagy, and invasion.
23887168 overexpression of Ephrin B2 receptor is associated with malignant mesothelioma.
23835497 Overexpression of EphB2 is associated with glioma.
23711177 EphB2 and Ephrin-B2 interactions mediate human mesenchymal stem cell suppression of activated T-cells.
23413357 Marrow stromal cell subpopulations express EphB2 engrafted in the fetal intestinal epithelium when xenografted into sheep
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of EPH receptor B2 (EPHB2) in peptide-treated PBMCs
22723427 High ephrin-B1 expression is associated with medulloblastoma.
22374425 Data indicated for the first time that EphrinB2 and EphB4 expressions increase according to the histopathological grade and KPS score of glioma, and their expression levels are related to the progression-free survival of glioblastoma patients.
22310282 EphB2 silencing increased tumor cell proliferation.
22233626 PTPN14 has a role in angiogenesis and/or arteriovenous fate, acting via EphrinB2 and ACVRL1/activin receptor-like kinase 1
22010211 High Eph-B2 is associated with Waldenstrom's macroglobulinemia.
21809346 Define the transcriptional targets of the reverse signaling by EphB2 acting exclusively as a ligand in epidermal keratinocyte differentiation.
21737611 EPHB2 interacts with EPHB6 in breast tumor cell lines
21603658 data suggest that genetic variation at the EphB2 locus may increase risk of sporadic prostate cancer risk in African American men.
21503576 The present study reveals a novel function for EphA1 and EphB2 in the induction of autophagy, suggesting a tumor suppressor role for these proteins in colorectal cancer.
21387540 EphB2 is an ephrin receptor and is up-regulated in invasive tumors but its role needs to be confirmed in further cases of Wilms tumors.
21292437 at least in the context of pancreatic carcinoma CFPAC-1 cells, EphB2 plays a tumor suppressor role in cell proliferation and apoptosis
21161727 Mutation in EphB2 gene is associated with colorectal adenocarcinoma
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20339854 Even a moderate level of EphB2 expression has effects on tumour cells which results in reduced migration and invasiveness and slows the growth of colonic tumour implants in an in vivo model.
20233847 Ephrin-B2 is a potent regulator of endothelial cell behavior, and indicate that the control of cell migration and angiogenesis by ephrins might involve both receptor-dependent and receptor-independent activities.
20046096 The MAPK pathway is important in the pro-death action of EphB2, through ERK1/2 phosphorylation and inhibition of this pathway using PD98059 counters EphB2-driven cell death.
19962662 EphB2 enhances proliferation through a kinase-dependent pathway and inhibits migration independent of its kinase activity
19913121 Observational study of gene-disease association. (HuGE Navigator)
19661068 peptide EphB2/CTF2 released to the cytosol by the gamma-secretase processing of EphB2 receptor, has tyrosine kinase activity, and directly phosphorylates the N-methyl-d-aspartate receptor (NMDAR) subunits in both cell lines and primary neuronal cultures
19597185 the ephrinB2/EphB4 axis is dysregulated in multiple myeloma, and its activation by EphB4-Fc inhibits myeloma growth and bone disease
19454503 results have confirmed that BRCA1, RASSF1, GSTP1 and EPHB2 promoter methylation was found in each prostate cancer sample
19366806 EphB4 is preferentially induced in colorectal cancer, in contrast to EphB2, whereby tumor cells acquire a survival advantage.
18957513 EphBR-ephrinB interactions lead to monocyte adhesion and transmigration through the vascular endothelium.
18713744 MMP7 and MMP9-mediated cleavage of EphB2 is induced by receptor-ligand interactions at the cell surface and that this event triggers cell-repulsive responses
18695888 Overexpression of the EphA4 gene and reduced expression of the EphB2 gene may thus be a useful predictor of liver metastasis in patients with colorectal cancer.
18682749 A tumor suppressor role for EPHB2 in rare colorectal cancer cases; rare germline EPHB2 variants may contribute to a small fraction of hereditary colorectal cancer.
18682749 Observational study of gene-disease association. (HuGE Navigator)
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17655843 In conclusion, alpha(2A)-adrenoreceptor activates ERK and Akt in intestinal cells by a common pathway which depends on PI3-kinase activation and results from EGF receptor transactivation.
17443671 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of EPH receptor B2 (EPHB2) in peptide-treated PBMCs
17295683 Genetic or epigenetic alterations of the EPHB2 gene might be an uncommon event in the development or progression of gastric cancers.
17234965 Notch signaling by induction of Dll1 was necessary & sufficient to regulate ephrin-B2 expression & induce ephrin-B2-dependent branching morphogenesis in human arterial EC.
16840724 novel link between EphB forward signaling and SDF-1-induced signaling demonstrates a mechanism for cooperative regulation of endothelial cell movement.
16819508 High EPHB2 mutation rate is associated with gastric tumors with microsatellite instability
16740153 Observational study of gene-disease association. (HuGE Navigator)
16740153 analysis of germline EPHB2 alterations in patients with colorectal tumors
16582626 These results demonstrate that the MAPK ERK signaling pathway contributes to the p53-independent antiproliferative functions of p14ARF. Furthermore, they identify a new mechanism by which phosphorylation at serine 216 participates to Cdc25C inactivation.
16272170 progressive loss of EphB2 expression seen in each critical step of colon carcinogenesis, including the onset of invasion, dedifferentiation and metastasis which are paralleled by adverse patient outcome
16166419 Deregulated EphB2 expression may play a role in several cancer types with loss of EphB2 expression serving as an indicator of the possible pathogenetic role of EphB2 signaling in the maintenance of tissue architecture of colon epithelium.
16155194 Observational study of gene-disease association. (HuGE Navigator)
15973414 loss of EphB expression represents a critical step in colorectal cancer progression
15722342 analysis of EphB1, EphB2, and EphB4-binding peptides interaction with antagonists with ephrin-like affinity
15718372 defined the expression patterns of human ephrinB2, EphB4, and EphB2 in normal vessels of neonates (i.e. umbilici) and adults and compared them with those in congenital venous malformations
15300251 our findings suggest that mutational inactivation of EPHB2 may be important in the progression and metastasis of prostate cancer.
15126357 Glioma migration and invasion are promoted by activation of EphB2 or inhibited by blocking EphB2. Dysregulation of EphB2 expression or function may underlie glioma invasion.
12136247 liganded to EFNB1 and EFNB2, expresssed in gastric cancer
12063024 role of extracellular signal-regulated kinase (ERK) during the differentiation of human monoblastic U937 cells stimulated by granulocyte-macrophage colony-stimulating factor (GM-CSF) and tumor necrosis factor (TNF)
11956217 RYK, a catalytically inactive receptor tyrosine kinase, associates with EphB2 and EphB3 but does not interact with AF-6.

AA Sequence

MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQN      1 - 70
NWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDT     71 - 140
IAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQET    141 - 210
LSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKAN    211 - 280
QGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDS    281 - 350
GGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF    351 - 420
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPT    421 - 490
NTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVV    491 - 560
IAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAG    561 - 630
EFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITE    631 - 700
FMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRF    701 - 770
LEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE    771 - 840
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIP    841 - 910
DYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQ    911 - 980
IQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESND    981 - 1050
CSCGG                                                                    1051 - 1055
//

Text Mined References (130)

PMID Year Title
26407069 2015 Expression of the Receptor Tyrosine Kinase EphB2 on Dendritic Cells Is Modulated by Toll-Like Receptor Ligation but Is Not Required for T Cell Activation.
26195670 2015 Myosin 1b functions as an effector of EphB signaling to control cell repulsion.
26119563 2015 Stimulation of EphB2 attenuates tau phosphorylation through PI3K/Akt-mediated inactivation of glycogen synthase kinase-3?.
25801123 2015 EphB2 activation is required for ependymoma development as well as inhibits differentiation and promotes proliferation of the transformed cell.
25643922 2015 Stimulation of EphB2/ephrin-B1 signalling by tumour necrosis factor alpha in human dental pulp stem cells.
25281742 2014 The Eph tyrosine kinase receptors EphB2 and EphA2 are novel proteolytic substrates of tissue factor/coagulation factor VIIa.
25257729 2014 Wild-type p53 inhibits pro-invasive properties of TGF-?3 in breast cancer, in part through regulation of EPHB2, a new TGF-? target gene.
25148033 2014 The differential expression of EphB2 and EphB4 receptor kinases in normal bladder and in transitional cell carcinoma of the bladder.
25012246 2014 Increased EphB2 expression predicts cholangiocarcinoma metastasis.
24803541 2014 EphB2 contributes to human naive B-cell activation and is regulated by miR-185.
24677421 2014 Completing the structural family portrait of the human EphB tyrosine kinase domains.
24612059 2014 Distinct profile of HIF1?, PTCH, EphB2, or DNA repair protein expression and BRAF mutation in colorectal serrated adenoma.
24522257 2014 EphrinB-mediated reverse signalling controls junctional integrity and pro-inflammatory differentiation of endothelial cells.
24439224 2014 EphB2 promotes cervical cancer progression by inducing epithelial-mesenchymal transition.
24222164 2013 A9 region in EPHB2 mutation is frequent in tumors with microsatellite instability. Analysis of prognosis.
24211352 2014 Role of the EphB2 receptor in autophagy, apoptosis and invasion in human breast cancer cells.
23887168 2013 Overexpression of EPH receptor B2 in malignant mesothelioma correlates with oncogenic behavior.
23835497 2013 MicroRNA-128 promotes cell-cell adhesion in U87 glioma cells via regulation of EphB2.
23711177 2013 EphB and Ephrin-B interactions mediate human mesenchymal stem cell suppression of activated T-cells.
23413357 2013 EphB2 isolates a human marrow stromal cell subpopulation with enhanced ability to contribute to the resident intestinal cellular pool.
22723427 2012 EphB2 activity plays a pivotal role in pediatric medulloblastoma cell adhesion and invasion.
22374425 2012 Expression of EphrinB2 and EphB4 in glioma tissues correlated to the progression of glioma and the prognosis of glioblastoma patients.
22310282 2012 EphB2 receptor controls proliferation/migration dichotomy of glioblastoma by interacting with focal adhesion kinase.
22233626 2012 Mouse and human strategies identify PTPN14 as a modifier of angiogenesis and hereditary haemorrhagic telangiectasia.
22010211 2012 Eph-B2/ephrin-B2 interaction plays a major role in the adhesion and proliferation of Waldenstrom's macroglobulinemia.
21809346 2012 Eph-2B, acting as an extracellular ligand, induces differentiation markers in epidermal keratinocytes.
21737611 A paradigm shift in EPH receptor interaction: biological relevance of EPHB6 interaction with EPHA2 and EPHB2 in breast carcinoma cell lines.
21603658 2011 EphB2 SNPs and sporadic prostate cancer risk in African American men.
21503576 2011 Sesamin induces autophagy in colon cancer cells by reducing tyrosine phosphorylation of EphA1 and EphB2.
21387540 2011 Expression profiling reveals MSX1 and EphB2 expression correlates with the invasion capacity of Wilms tumors.
21292437 2011 Promoted cancer growth by stimulating cell proliferation and decreasing apoptosis using a lentivirus-based EphB2 RNAi in pancreatic carcinoma CFPAC-1 cells.
21161727 2011 Influence of A9 region mutation in EphB2 gene in the prognosis of patients with colorectal adenocarcinoma.
20838624 2010 Mutational profiling of kinases in human tumours of pancreatic origin identifies candidate cancer genes in ductal and ampulla of vater carcinomas.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20339854 2010 Loss of cell-surface receptor EphB2 is important for the growth, migration, and invasiveness of a colon cancer cell line.
20233847 2010 Ephrin-B2 regulates endothelial cell morphology and motility independently of Eph-receptor binding.
20046096 2010 The EphB2 tumor suppressor induces autophagic cell death via concomitant activation of the ERK1/2 and PI3K pathways.
19962662 2009 Proliferation and tumor suppression: not mutually exclusive for Eph receptors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19661068 2009 Peptide EphB2/CTF2 generated by the gamma-secretase processing of EphB2 receptor promotes tyrosine phosphorylation and cell surface localization of N-methyl-D-aspartate receptors.
19597185 2009 The ephrinB2/EphB4 axis is dysregulated in osteoprogenitors from myeloma patients and its activation affects myeloma bone disease and tumor growth.
19454503 Methylation analysis of BRCA1, RASSF1, GSTP1 and EPHB2 promoters in prostate biopsies according to different degrees of malignancy.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366806 2009 Preferential induction of EphB4 over EphB2 and its implication in colorectal cancer progression.
18957513 2008 Involvement of endothelial ephrin-B2 in adhesion and transmigration of EphB-receptor-expressing monocytes.
18713744 2008 Ephrin-B2-induced cleavage of EphB2 receptor is mediated by matrix metalloproteinases to trigger cell repulsion.
18695888 2008 Overexpression of EphA4 gene and reduced expression of EphB2 gene correlates with liver metastasis in colorectal cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18682749 2008 Germline EPHB2 receptor variants in familial colorectal cancer.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
17897949 2007 Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition.
17655843 2007 EGF receptor transactivation and PI3-kinase mediate stimulation of ERK by alpha(2A)-adrenoreceptor in intestinal epithelial cells: a role in wound healing.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17295683 2007 Genetic and epigenetic analysis of the EPHB2 gene in gastric cancers.
17255949 2007 Mxi2 promotes stimulus-independent ERK nuclear translocation.
17234965 2007 Notch ligand Delta-like 1 is essential for postnatal arteriogenesis.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16840724 2006 EphB2 and EphB4 receptors forward signaling promotes SDF-1-induced endothelial cell chemotaxis and branching remodeling.
16819508 2007 High EPHB2 mutation rate in gastric but not endometrial tumors with microsatellite instability.
16740153 2006 EPHB2 germline variants in patients with colorectal cancer or hyperplastic polyposis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16582626 2006 p14ARF triggers G2 arrest through ERK-mediated Cdc25C phosphorylation, ubiquitination and proteasomal degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16298995 2006 EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation.
16272170 2006 Reduced expression of EphB2 that parallels invasion and metastasis in colorectal tumours.
16166419 2005 EphB2 expression across 138 human tumor types in a tissue microarray: high levels of expression in gastrointestinal cancers.
16155194 2006 A common nonsense mutation in EphB2 is associated with prostate cancer risk in African American men with a positive family history.
15973414 2005 EphB receptor activity suppresses colorectal cancer progression.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15848800 2005 Vav family GEFs link activated Ephs to endocytosis and axon guidance.
15821731 2005 EphrinB-EphB signalling regulates clathrin-mediated endocytosis through tyrosine phosphorylation of synaptojanin 1.
15722342 2005 EphB receptor-binding peptides identified by phage display enable design of an antagonist with ephrin-like affinity.
15718372 2005 Altered expression patterns of EphrinB2 and EphB2 in human umbilical vessels and congenital venous malformations.
15300251 2004 Nonsense-mediated decay microarray analysis identifies mutations of EPHB2 in human prostate cancer.
15126357 2004 The phosphorylation of EphB2 receptor regulates migration and invasion of human glioma cells.
15107857 2004 Repelling class discrimination: ephrin-A5 binds to and activates EphB2 receptor signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972619 2003 Phosphorylation of the carboxyl-terminal transactivation domain of c-Fos by extracellular signal-regulated kinase mediates the transcriptional activation of AP-1 and cellular transformation induced by platelet-derived growth factor.
12546821 2003 Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389031 2002 EphB receptors regulate dendritic spine development via intersectin, Cdc42 and N-WASP.
12297313 2002 Glucose induced MAPK signalling influences NeuroD1-mediated activation and nuclear localization.
12136247 2002 Expression profile of EFNB1, EFNB2, two ligands of EPHB2 in human gastric cancer.
12058067 2002 Extracellular signal-regulated kinase phosphorylates tumor necrosis factor alpha-converting enzyme at threonine 735: a potential role in regulated shedding.
12039842 2002 EphB ligand, ephrinB2, suppresses the VEGF- and angiopoietin 1-induced Ras/mitogen-activated protein kinase pathway in venous endothelial cells.
11956217 2002 RYK, a catalytically inactive receptor tyrosine kinase, associates with EphB2 and EphB3 but does not interact with AF-6.
11799243 2002 Modulation of NMDA receptor-dependent calcium influx and gene expression through EphB receptors.
11780069 2001 Crystal structure of an Eph receptor-ephrin complex.
11754835 2001 Kinase-independent requirement of EphB2 receptors in hippocampal synaptic plasticity.
11585923 2001 Downregulation of the Ras-mitogen-activated protein kinase pathway by the EphB2 receptor tyrosine kinase is required for ephrin-induced neurite retraction.
11580899 2001 EphB/syndecan-2 signaling in dendritic spine morphogenesis.
11494128 2001 Multiple signaling interactions of Abl and Arg kinases with the EphB2 receptor.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11186936 2000 Suggestive evidence for a site specific prostate cancer gene on chromosome 1p36. The CRC/BPG UK Familial Prostate Cancer Study Coordinators and Collaborators. The EU Biomed Collaborators.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
11042694 2000 The ternary complex factor Net contains two distinct elements that mediate different responses to MAP kinase signalling cascades.
10839360 2000 EphB2 guides axons at the midline and is necessary for normal vestibular function.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10648599 2000 Extracellular signal-regulated kinase binds to TFII-I and regulates its activation of the c-fos promoter.
10644995 2000 Replacing two conserved tyrosines of the EphB2 receptor with glutamic acid prevents binding of SH2 domains without abrogating kinase activity and biological responses.
10572014 1999 Multiple in vivo tyrosine phosphorylation sites in EphB receptors.
10570155 1999 An Eph receptor regulates integrin activity through R-Ras.
10542222 1999 A novel signaling intermediate, SHEP1, directly couples Eph receptors to R-Ras and Rap1A.
10537323 1999 Signaling pathways and structural domains required for phosphorylation of EMS1/cortactin.
10523848 1999 alphaPIX nucleotide exchange factor is activated by interaction with phosphatidylinositol 3-kinase.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10480933 1999 90-kDa ribosomal S6 kinase is phosphorylated and activated by 3-phosphoinositide-dependent protein kinase-1.
10330152 1999 Transcriptional repressor ERF is a Ras/mitogen-activated protein kinase target that regulates cellular proliferation.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10053012 1999 Evidence for a rare prostate cancer-susceptibility locus at chromosome 1p36.
9933164 1999 Oligomeric structure of the human EphB2 receptor SAM domain.
9883737 1998 PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.
9707552 1998 PDZ-domain-mediated interaction of the Eph-related receptor tyrosine kinase EphB3 and the ras-binding protein AF6 depends on the kinase activity of the receptor.
9696046 1998 A variant transcript encoding an isoform of the human protein tyrosine kinase EPHB2 is generated by alternative splicing and alternative use of polyadenylation signals.
9632142 1998 Complex formation between EphB2 and Src requires phosphorylation of tyrosine 611 in the EphB2 juxtamembrane region.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9499402 1998 Eph receptors discriminate specific ligand oligomers to determine alternative signaling complexes, attachment, and assembly responses.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9233798 1997 Juxtamembrane tyrosine residues couple the Eph family receptor EphB2/Nuk to specific SH2 domain proteins in neuronal cells.
8878483 1996 Bidirectional signalling through the EPH-family receptor Nuk and its transmembrane ligands.
8798570 1996 Ligand activation of ELK receptor tyrosine kinase promotes its association with Grb10 and Grb2 in vascular endothelial cells.
8589679 1995 Molecular characterization and chromosomal localization of DRT (EPHT3): a developmentally regulated human protein-tyrosine kinase gene of the EPH family.
8033077 1994 Overexpression of ERK, an EPH family receptor protein tyrosine kinase, in various human tumors.
7898931 1995 cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases.
7816602 1994 Phosphorylation of the c-Fos and c-Jun HOB1 motif stimulates its activation capacity.
7688222 1993 Identification of protein-tyrosine kinase genes preferentially expressed in embryo stomach and gastric cancer.
7601466 1995 Identification of the human ERK gene as a putative receptor tyrosine kinase and its chromosomal localization to 1p36.1: a comparative mapping of human, mouse, and rat chromosomes.
1648701 1991 eek and erk, new members of the eph subclass of receptor protein-tyrosine kinases.