Property Summary

NCBI Gene PubMed Count 27
PubMed Score 43.61
PubTator Score 69.98

Knowledge Summary

Patent (13,866)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.426 1.1e-08
group 3 medulloblastoma 2.600 2.2e-05
medulloblastoma, large-cell 1.500 1.4e-03
ovarian cancer 1.200 1.0e-07
psoriasis 2.100 1.6e-16

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
25683004 Human miR-10a and EphA8 regulate epithelial-mesenchymal transition (EMT) to affect glioma cell migration and invasion.
22291991 RINL, as a GEF for Rab5 subfamily, is implicated in the EphA8-degradation pathway via its interaction with odin.
20029409 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
15782114 EphA8 receptor is capable of inducing a sustained increase in MAPK activity, thereby promoting neurite outgrowth in neuronal cells
12681484 role in stimulated cell migration in presnce of p110 gamma PI-3 kinase

AA Sequence

MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTY      1 - 70
QVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQES     71 - 140
QFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRN    141 - 210
LAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGF    211 - 280
YKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAP    281 - 350
PLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD    351 - 420
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTL    421 - 490
KAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLL    491 - 560
LICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAEPHTYEEPGRAGRSFTREI    561 - 630
EASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLE    631 - 700
GVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDS    701 - 770
NLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW    771 - 840
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSR    841 - 910
CPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGH    911 - 980
QKKILGSIQTMRAQLTSTQGPRRHL                                                 981 - 1005
//

Text Mined References (31)

PMID Year Title
25683004 2015 miR-10a controls glioma migration and invasion through regulating epithelial-mesenchymal transition via EphA8.
22291991 2012 RINL, guanine nucleotide exchange factor Rab5-subfamily, is involved in the EphA8-degradation pathway with odin.
20496116 2010 EphA8-ephrinA5 signaling and clathrin-mediated endocytosis is regulated by Tiam-1, a Rac-specific guanine nucleotide exchange factor.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17875921 2007 Identification of phosphotyrosine binding domain-containing proteins as novel downstream targets of the EphA8 signaling function.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15782114 2005 The EphA8 receptor induces sustained MAP kinase activation to promote neurite outgrowth in neuronal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15271258 2004 Eph receptors, ephrins, and synaptic function.
15194108 2004 Eph receptors in the adult brain.
14986683 2004 Neurobiology: New connections between integrins and axon guidance.
12681484 2003 The p110 gamma PI-3 kinase is required for EphA8-stimulated cell migration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416136 2001 The EphA8 receptor regulates integrin activity through p110gamma phosphatidylinositol-3 kinase in a tyrosine kinase activity-independent manner.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10515610 1999 Characterization of ephrin-A1 and ephrin-A4 as ligands for the EphA8 receptor protein tyrosine kinase.
10498895 1999 Phosphorylation at Tyr-838 in the kinase domain of EphA8 modulates Fyn binding to the Tyr-615 site by enhancing tyrosine kinase activity.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9568399 1998 Cell-contact-dependent signalling in axon growth and guidance: Eph receptor tyrosine kinases and receptor protein tyrosine phosphatase beta.
9530499 1998 The ephrins and Eph receptors in neural development.
9361271 1997 A coherent nomenclature for Eph receptors and their ligands.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9214628 1997 Aberrant axonal projections in mice lacking EphA8 (Eek) tyrosine protein kinase receptors.
9053851 1997 The Eek receptor, a member of the Eph family of tyrosine protein kinases, can be activated by three different Eph family ligands.
1648701 1991 eek and erk, new members of the eph subclass of receptor protein-tyrosine kinases.