Property Summary

NCBI Gene PubMed Count 35
PubMed Score 184.50
PubTator Score 30.54

Knowledge Summary

Patent (13,013)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 3.0e-03
posterior fossa group B ependymoma -3.000 1.8e-07
oligodendroglioma -2.500 4.8e-03
glioblastoma -4.600 3.7e-07
osteosarcoma 1.738 2.8e-02
medulloblastoma -4.400 1.5e-08
cystic fibrosis -1.382 5.6e-06
atypical teratoid / rhabdoid tumor -3.500 2.8e-04
medulloblastoma, large-cell -3.800 4.6e-04
primitive neuroectodermal tumor -2.300 3.1e-02
interstitial cystitis -1.100 3.0e-03
pediatric high grade glioma -3.200 5.0e-05
pilocytic astrocytoma -1.400 4.9e-02

 MGI Phenotype (1)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (10)

PMID Text
25623065 demonstrate that a new monoclonal antibody against human EphA5 sensitized lung cancer cells and human lung cancer xenografts to radiotherapy and significantly prolonged survival, thus suggesting the likelihood of translational applications
25609195 Our study provides evidence that EphA5 is a potential target for epigenetic silencing in primary prostate cancer and is a potentially valuable prognosis predictor and thereapeutic marker for prostate cancer.
24086308 unbound EphA5 LBD appears to comprise an ensemble of open conformations that have only small variations over the loops and appear ready to bind ephrin-A ligands
24029132 These results indicate that EphA5 may be a negative regulator of bone formation.
23824631 Insertional translocation leading to a 4q13 duplication including the EPHA5 gene is associated with attention-deficit. hyperactivity disorder
22079638 these data suggest that miR-34a is a negative modulator of chondrogenesis, particularly in migration of chondroblasts, by targeting EphA5 and resulting inhibition of cellular condensation during chondrogenesis of chick limb mesenchymal cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19949912 Eph-A5 and Eph-A7 staining intensity was identified as independent prognostic factors for pancreatic ductal adenocarcinoma
19733895 EphA5 might be a potential target for epigenetic silencing in primary breast cancer and a valuable molecular marker for breast cancer carcinogenesis and progression.
16737551 increased levels of ephrins A1 and A5 in the presence of high expression of Ephs A1 and A2 lead to a more aggressive ovarian cancer phenotype

AA Sequence

MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVM      1 - 70
GDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSL     71 - 140
PGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGF    141 - 210
YLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEG    211 - 280
EWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPP    281 - 350
TMACTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG    351 - 420
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQ    421 - 490
EPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETT    491 - 560
PVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDP    561 - 630
EEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKR    631 - 700
ELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDG    701 - 770
QFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI    771 - 840
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQL    841 - 910
MLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMG    911 - 980
RYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL                 981 - 1037
//

Text Mined References (39)

PMID Year Title
25623065 2015 Receptor tyrosine kinase EphA5 is a functional molecular target in human lung cancer.
25609195 2015 Downregulation of EphA5 by promoter methylation in human prostate cancer.
24086308 2013 Unique structure and dynamics of the EphA5 ligand binding domain mediate its binding specificity as revealed by X-ray crystallography, NMR and MD simulations.
24029132 2013 After repeated division, bone marrow stromal cells express inhibitory factors with osteogenic capabilities, and EphA5 is a primary candidate.
23824631 2013 Insertional translocation leading to a 4q13 duplication including the EPHA5 gene in two siblings with attention-deficit hyperactivity disorder.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
22079638 2011 MicroRNA-34a regulates migration of chondroblast and IL-1?-induced degeneration of chondrocytes by targeting EphA5.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19949912 2010 Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma.
19733895 2010 Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer.
19036963 2008 A TrkB/EphrinA interaction controls retinal axon branching and synaptogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16737551 2006 Over-expression of Eph and ephrin genes in advanced ovarian cancer: ephrin gene expression correlates with shortened survival.
16381901 2006 The LIFEdb database in 2006.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10531456 1999 Regulation of learning by EphA receptors: a protein targeting study.
10516308 1999 A role for the Eph ligand ephrin-A3 in entorhino-hippocampal axon targeting.
10375373 1999 Immunohistochemical localization of EphA5 in the adult human central nervous system.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10064801 1999 Functional activation of EphA5 receptor does not promote cell proliferation in the aberrant EphA5 expressing human glioblastoma U-118 MG cell line.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9321687 1997 A link between axon guidance and axon fasciculation suggested by studies of the tyrosine kinase receptor EphA5/REK7 and its ligand ephrin-A5/AL-1.
9321686 1997 Regulation of topographic projection by the Eph family receptor Bsk (EphA5) and its ligands.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9191074 1997 Extensive splice variation and localization of the EHK-1 receptor tyrosine kinase in adult human brain and glial tumors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
7898931 1995 cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases.
7748564 1995 Cloning of AL-1, a ligand for an Eph-related tyrosine kinase receptor involved in axon bundle formation.
7528718 1994 A YAC contig spanning a cluster of human type III receptor protein tyrosine kinase genes (PDGFRA-KIT-KDR) in chromosome segment 4q12.