Property Summary

NCBI Gene PubMed Count 55
PubMed Score 234.48
PubTator Score 99.65

Knowledge Summary

Patent (39,568)

TINX Plot

  Disease (5)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.900 2.9e-07
astrocytic glioma -1.700 6.1e-03
ependymoma -2.300 1.1e-02
oligodendroglioma -2.700 2.8e-02
uncontrolled asthma 1.100 1.7e-02
glioblastoma -2.000 4.3e-04
osteosarcoma 1.331 4.8e-02
medulloblastoma -3.800 3.9e-05
cystic fibrosis 1.419 6.2e-05
atypical teratoid / rhabdoid tumor -1.900 3.2e-02
medulloblastoma, large-cell -2.300 6.7e-03
tuberculosis -2.800 9.8e-08
intraductal papillary-mucinous adenoma (... 1.100 4.0e-02
intraductal papillary-mucinous carcinoma... 2.200 2.1e-02
intraductal papillary-mucinous neoplasm ... 2.200 2.4e-02
lung cancer 1.200 5.4e-03
active Crohn's disease 1.427 7.1e-03
Parkinson's disease -1.200 1.2e-02
pancreatic cancer 1.300 4.9e-03
pediatric high grade glioma -1.300 2.0e-02
pilocytic astrocytoma -3.200 2.9e-05
lung carcinoma 1.600 8.7e-14
Breast cancer -1.200 1.1e-02
invasive ductal carcinoma -1.200 3.3e-03

 CSPA Cell Line (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
26376612 EPHA4 is overexpressed but not functionally active in Sezary syndrome.
24217950 EphA4 induced accumulation of amyloid precursor protein through a Lyn-mediated pathway.
23959867 Data indicate that ephrin-A5 binding directly facilitates the formation of Eph/ephrin clusters by inducing conformational changes in the ligand-binding domain (LBD) of EphA4.
23429488 High Eph A4 expression is associated with choriocarcinoma invasion.
22922411 Epha4 modulates the vulnerability of motor neurons to axonal degeneration and may represent a new target for therapeutic intervention in ALS.
22807579 EphA4 gene expression is associated with an improved outcome in patients with resected lung adenocarcinoma, possibly by affecting cancer cell migration and invasion.
22318127 The present study demonstrates that EphA4 is expressed on neurons in multiple regions of the intact human brain and is markedly upregulated on activated astrocytes after TBI
22273509 The platelet P2Y12 receptor contributes to granule secretion through Ephrin A4 receptor.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21873938 The present data suggest that Eph-A2, but not Eph-A4, overexpression may be associated with the malignant transformation of thyroid neoplasia.
21444754 EphA4 expression maintains adult neural stem cells in an undifferentiated state.
20678482 these results suggest that the ligand promiscuity of the Ephs is directly correlated with the structural flexibility of the ligand-binding surface of the receptor.
20184660 The signaling complex appears to integrate the input from FGFR and EphA4, and release the output signal through FRS2alpha.
20100581 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19949912 Eph-A4 expression was significantly associated with tumor proliferative capacity in pancreatic ductal adenocarcinoma.
18837080 Overexpression of the receptor tyrosine kinase EphA4 in human gastric cancers.
18790757 These results indicate that EphA4 plays an important role in malignant phenotypes of glioblastoma by enhancing cell proliferation and migration through accelerating a canonical FGFR signaling pathway.
18695888 overexpression of the EphA4 gene and reduced expression of the EphB2 gene might promote liver metastasis in colorectal cancer
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16965393 Overexpression of EphA4 receptor is associated with pancreatic ductal adenocarcinoma
16574431 The expression of EphA4 in astrocyte progenitor cells and in the astrocyte meshwork at the optic nerve head has implications for optic nerve pathologies.
16365308 FGF-receptor-mediated mitogen-activated protein kinase stimulation is potentiated in cells costimulated with ephrin-A1
15994237 EphA4 is physically associated with alpha(IIb)beta(3) in resting platelets, increases its surface expression when platelets are activated, and colocalizes with alpha(IIb)beta(3) at sites of contact between platelets.
15313894 The tyrosine kinase receptor EphA4 and the potentially oncogenic transcription factor Twist were highly and selectively expressed in T cells of patients with Sezary Syndrome.
14576067 Eph/ephrin signaling enhances the ability of platelet agonists to cause aggregation provided that those agonists can increase cytosolic Ca(++) and this is accomplished in part by activating Rap1
12084815 Human platelets express EphA4 and EphB1, and the ligand, ephrinB1. Forced clustering of EphA4 or ephrinB1 led to cytoskeletal reorganization, adhesion to fibrinogen, and alpha-granule secretion.

AA Sequence

MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTY      1 - 70
QVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIREN     71 - 140
QFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRN    141 - 210
LAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGY    211 - 280
YKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSS    281 - 350
PQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS    351 - 420
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRI    421 - 490
VRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLV    491 - 560
VILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVG    561 - 630
EFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITE    631 - 700
YMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRV    701 - 770
LEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG    771 - 840
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEF    841 - 910
SAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMH    911 - 980
GRMVPV                                                                    981 - 986
//

Text Mined References (63)

PMID Year Title
26376612 2015 EPHA4 is overexpressed but not functionally active in Sézary syndrome.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24217950 2014 Ligand-dependent activation of EphA4 signaling regulates the proteolysis of amyloid precursor protein through a Lyn-mediated pathway.
23959867 2013 Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23429488 2013 Eph-ephrin A system regulates human choriocarcinoma-derived JEG-3 cell invasion.
22922411 2012 EPHA4 is a disease modifier of amyotrophic lateral sclerosis in animal models and in humans.
22807579 2012 Global evaluation of Eph receptors and ephrins in lung adenocarcinomas identifies EphA4 as an inhibitor of cell migration and invasion.
22318127 2012 Expression and activation of EphA4 in the human brain after traumatic injury.
22273509 2012 The platelet P2Y12 receptor contributes to granule secretion through Ephrin A4 receptor.
21935409 2011 Eph/ephrin profiling in human breast cancer reveals significant associations between expression level and clinical outcome.
21873938 2011 Eph-A2 and Eph-A4 expression in human benign and malignant thyroid lesions: an immunohistochemical study.
21444754 2011 EphA4 preserves postnatal and adult neural stem cells in an undifferentiated state in vivo.
20678482 2010 Crystal structure of the ligand-binding domain of the promiscuous EphA4 receptor reveals two distinct conformations.
20184660 2010 Ternary complex formation of EphA4, FGFR and FRS2? plays an important role in the proliferation of embryonic neural stem/progenitor cells.
20100581 2010 Whole genome association study of brain-wide imaging phenotypes for identifying quantitative trait loci in MCI and AD: A study of the ADNI cohort.
19949912 2010 Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma.
19875447 2010 Structural characterization of the EphA4-Ephrin-B2 complex reveals new features enabling Eph-ephrin binding promiscuity.
19836338 2009 Structural plasticity of eph receptor A4 facilitates cross-class ephrin signaling.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18837080 2008 Overexpression of the receptor tyrosine kinase EphA4 in human gastric cancers.
18790757 2008 EphA4 promotes cell proliferation and migration through a novel EphA4-FGFR1 signaling pathway in the human glioma U251 cell line.
18708347 2008 Crystal structure and NMR binding reveal that two small molecule antagonists target the high affinity ephrin-binding channel of the EphA4 receptor.
18695888 2008 Overexpression of EphA4 gene and reduced expression of EphB2 gene correlates with liver metastasis in colorectal cancer.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18094260 2007 The EphA4 receptor regulates neuronal morphology through SPAR-mediated inactivation of Rap GTPases.
17847007 2007 Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17143272 2007 Cdk5 regulates EphA4-mediated dendritic spine retraction through an ephexin1-dependent mechanism.
16965393 2006 EphA4 receptor, overexpressed in pancreatic ductal adenocarcinoma, promotes cancer cell growth.
16574431 Temporal regulation of EphA4 in astroglia during murine retinal and optic nerve development.
16540516 2006 Cell mixing at a neural crest-mesoderm boundary and deficient ephrin-Eph signaling in the pathogenesis of craniosynostosis.
16365308 2005 Trans-activation of EphA4 and FGF receptors mediated by direct interactions between their cytoplasmic domains.
15994237 2005 Eph kinases and ephrins support thrombus growth and stability by regulating integrin outside-in signaling in platelets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313894 2004 Aberrant expression of the tyrosine kinase receptor EphA4 and the transcription factor twist in Sézary syndrome identified by gene expression analysis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576067 2004 Signaling by ephrinB1 and Eph kinases in platelets promotes Rap1 activation, platelet adhesion, and aggregation via effector pathways that do not require phosphorylation of ephrinB1.
12775584 2003 EphA4-mediated Rho activation via Vsm-RhoGEF expressed specifically in vascular smooth muscle cells.
12761826 2003 EphA4 provides repulsive signals to developing cochlear ganglion neurites mediated through ephrin-B2 and -B3.
12496762 2003 Control of hippocampal dendritic spine morphology through ephrin-A3/EphA4 signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383247 2002 Ephrin-B3-EphA4 interactions regulate the growth of specific thalamocortical axon populations in vitro.
12084815 2002 Interactions between Eph kinases and ephrins provide a mechanism to support platelet aggregation once cell-to-cell contact has occurred.
11336673 2001 EphA receptors regulate growth cone dynamics through the novel guanine nucleotide exchange factor ephexin.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
11085874 2000 The EphA4 receptor tyrosine kinase is necessary for the guidance of nasal retinal ganglion cell axons in vitro.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10607706 2000 A splice variant of human ephrin-A4 encodes a soluble molecule that is secreted by activated human B lymphocytes.
10366629 1999 Ephrin-A binding and EphA receptor expression delineate the matrix compartment of the striatum.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9484836 1998 Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.
9345045 1997 Regulated expression of the Eph-related receptor tyrosine kinase Hek11 in early human B lymphopoiesis.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8622893 1996 A juxtamembrane autophosphorylation site in the Eph family receptor tyrosine kinase, Sek, mediates high affinity interaction with p59fyn.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7898931 1995 cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases.