Property Summary

Ligand Count 11
NCBI Gene PubMed Count 68
PubMed Score 255.48
PubTator Score 99.65

Knowledge Summary

Patent (39,568)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.2
Disease Target Count Z-score Confidence
Paralytic squint 5 3.234 1.6
Cancer 2499 3.141 1.6
Ureterocele 14 3.075 1.5

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.427 7.1e-03
astrocytic glioma -1.700 6.1e-03
Astrocytoma, Pilocytic -2.200 8.3e-06
atypical teratoid / rhabdoid tumor -1.900 3.2e-02
Breast cancer -1.200 1.1e-02
cystic fibrosis 1.419 6.2e-05
ependymoma -1.500 3.3e-02
glioblastoma -1.700 1.2e-04
group 3 medulloblastoma -2.400 5.0e-03
intraductal papillary-mucinous adenoma (... 1.100 4.0e-02
intraductal papillary-mucinous carcinoma... 2.100 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.3e-02
invasive ductal carcinoma -1.200 3.3e-03
lung cancer 1.200 5.4e-03
lung carcinoma 1.600 8.7e-14
malignant mesothelioma -2.900 2.9e-07
medulloblastoma, large-cell -2.300 6.7e-03
oligodendroglioma -1.500 4.1e-02
osteosarcoma 1.331 4.8e-02
pancreatic cancer 1.300 4.9e-03
Parkinson's disease -1.200 1.2e-02
pediatric high grade glioma -1.300 2.0e-02
tuberculosis -2.000 1.2e-08
uncontrolled asthma 1.100 1.7e-02

 CSPA Cell Line (4)

Protein-protein Interaction (1)

PDB (15)

Gene RIF (36)

AA Sequence

MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTY      1 - 70
QVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIREN     71 - 140
QFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRN    141 - 210
LAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGY    211 - 280
YKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSS    281 - 350
PQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS    351 - 420
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRI    421 - 490
VRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLV    491 - 560
VILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVG    561 - 630
EFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITE    631 - 700
YMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRV    701 - 770
LEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG    771 - 840
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEF    841 - 910
SAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMH    911 - 980
GRMVPV                                                                    981 - 986
//

Text Mined References (75)

PMID Year Title