Property Summary

NCBI Gene PubMed Count 213
PubMed Score 785.10
PubTator Score 341.83

Knowledge Summary

Patent (192,584)

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis 1.600 1.8e-54
atypical teratoid / rhabdoid tumor 1.100 9.0e-03
Atopic dermatitis 1.100 1.8e-04
adrenocortical carcinoma -1.053 3.6e-06
pancreatic ductal adenocarcinoma liver m... 1.795 7.4e-03
intraductal papillary-mucinous neoplasm ... 2.100 3.6e-03
sarcoidosis -1.100 3.7e-02
pancreatic cancer 1.400 2.2e-05
group 3 medulloblastoma 1.400 3.0e-02
nasopharyngeal carcinoma -1.200 1.7e-07
lung carcinoma -1.200 2.6e-10
spina bifida -1.840 4.8e-02
Breast cancer -1.600 3.4e-22
ulcerative colitis 2.000 2.0e-06
ovarian cancer 1.600 8.3e-06
chronic rhinosinusitis -1.171 3.7e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (174)

PMID Text
26900323 Mis-localization of two of the mutant proteins in epithelial cells suggests that some disease-causing mutations in EPHA2 likely affect lens epithelial cell homeostasis and contribute to cataract.
26843134 These data suggest that miR-26b enhances the radiosensitivity of 97H hepatocellular cancer cells by targeting EphA2 protein.
26744526 Role for EPHA2 in the maintenance of cell survival of TKI-resistant, EGFR-mutant lung cancer and indicate that EPHA2 may serve as a useful therapeutic target in TKI-resistant tumors.
26722543 EphA2 protein may be used as a new marker for the prognosis of clear cell renal cell carcinoma.
26565750 Based on these findings we propose that EphA2 promotes cell adhesion by an unknown signaling pathway that largely depends on the extracellular region of EphA2 and the activation of outside-in integrin signaling
26363067 EphA2 forms dimers in the plasma membrane of HEK293T cells in the absence of ephrin ligand binding, suggesting that the current seeding mechanism model of EphA2 activation is incomplete.
26283684 EphA2 Expression Is a Key Driver of Migration and Invasion and a Poor Prognostic Marker in Colorectal Cancer
26191168 Overexpression of miR-26b dramatically inhibited the proliferation, invasion, and migration of hepatocellular carcinoma cells by targeting EphA2.
26177500 EphA2/FAK/RhoA signaling pathway plays a critical role in the malignant cellular behavior of renal cell carcinoma
26130649 Data show that ligand-binding domain of receptor tyrosine kinase EphA2 is cleaved frequently by the membrane metalloproteinase MT1-MMP.
26120079 peptide fragments of Odin-Sam1 interacting with EphA2-Sam
26088362 EPHA2 expression is correlated with poor survival specifically in basal-like breast cancer and its expression is repressed by miR-200a through direct interaction with the 3'UTR of EPHA2.
25906164 we show that EphA2 is an undiscovered important surface and intracellular signaling receptor that is crucial for chlamydial infection and development.
25613580 Results show that MiR-26a is overexpressed in patients with atherosclerosis and its role in the disease is mediated by its target EphA2 via a mechanism involving the p38 MAPK/VEGF pathway.
25542448 EPHA2 is a mediator of vemurafenib resistance and a novel therapeutic target in melanoma
25542447 Ligand-independent EPHA2 signaling drives the adoption of a targeted therapy-mediated metastatic melanoma phenotype
25478832 Here, structures of EphA2 representing various activation states are presented.
25366905 Silencing EPHA2 inhibits cell proliferation, invasion, and migration in esophageal squamous-cell carcinoma cells. EPHA2 is frequently overexpressed and activated in several malignancies
25344320 Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through beta-catenin
25310629 Geldanamycin inhibits MGC803 cell proliferation and induces cell apoptosis by upregulating expression of EphA2.
25281742 Data indicate that the Eph tyrosine kinase receptors EphB2 and EphA2 are involved in factor/coagulation factor VIIa (TF/FVIIa) signaling.
25239188 These findings implicate EphB6 as a negative regulator of EphA2 oncogenic signaling.
25063221 MicroRNA 520d-3p inhibits gastric cancer cell proliferation, migration, and invasion by downregulating EphA2 expression.
25023279 results indicate LMW-HA-mediated transactivation of EphA2 is required for PATJ and Dbs membrane recruitment and subsequent RhoA activation required for angiogenesis
24969670 Findings show that EFNA1 expression is a useful marker for predicting a high risk of recurrence in hepatocellular carcinoma patients but not EPHA2.
24940039 Identification of a novel pathogenic EPHA2 allele further implicates this gene in congenital cataract.
24908114 Overexpression of Ephrin A2 receptor in cancer stromal cells is a prognostic factor for the relapse of gastric cancer.
24899181 Interaction of KSHV with EphA2 occurs in a fashion similar to that of the natural ephrin ligands.
24864260 EphA2 played a key role in vasculogenic mimicry formation of head and neck squamous cell carcinoma through regulation of epithelial-mesenchymal transition.
24853748 EphA2-ephrinA1 trans-endocytosis is sensitive to the mechanical properties of a cell's microenvironment
24825902 Setting up different signaling platforms defined by selective interactions with adaptor proteins thus adds another level of regulation to EphA2 signaling.
24733396 Data indicate that mutations introduced into the alternative dimerization motifs of the EphA2 receptor tyrosine kinase transmembrane domain induced an opposite effect on receptor activity.
24717580 The present data suggest that TS causes significant damage to the BAEpCs via induction of EphA2 and downregulation of E-cadherin
24713656 these data demonstrate a role for EPHA2 in the maintenance and progression of NSCLCs and provide evidence that ALW-II-41-27 effectively inhibits EPHA2-mediated tumor growth in preclinical models of NSCLC.
24673449 The present study does not support a major role of EphA2 in cataractogenesis in an Estonian population.
24647573 Data indicate that EphA2 Receptor Tyrosine Kinase is a direct target of miR-141.
24607842 A critical role for JNK signaling in EPHA2-dependent lung cancer cell proliferation and motility.
24503792 Overexpression of ephrin type-A receptor 2 is correlated with the number of tumors, capsular integrity, portal vein cancer thrombus and clinical stages of hepatoma.
24488013 the results show that EphA2 endows invasiveness of glioma stem cells in vivo in cooperation with Akt and regulates glioma stem cell properties
24486585 Our in vitro and in vivo results provide a new understanding of EphA2 targeting by dasatinib and identify key predictors of therapeutic response.
24458982 These data reveal a novel role for VEGF as a regulator of EphA2 expression in the brain endothelial cells and provide insights into the molecular mechanisms of VEGF-mediated changes in paracellular permeability.
24457997 SLAP controls SRC/EPHA2/AKT signalling via destabilization of the SRC substrate and receptor tyrosine kinase EPHA2
24285539 LKB1 expression in cancer cell resulted in dephosphorylation of several tumor-enhancing RTKs, including ErbB2, hepatocyte growth factor receptor (c-Met), EphA2, rearranged during transfection (RET), and insulin-like growth factor I receptor.
24141256 Our data demonstrate that the ephrin A1/EphA2 pathway may serve as a target to facilitate trafficking of human cardiac progenitor cells in the senescent myocardium.
24064975 Ephrin type-A receptor 2 was highly upregulated and the most abundant surface protein on osteosarcoma cells.
24014202 Thus mutations in EPHA2 account for 4.7% of inherited cataract cases in South-Eastern Australia.
23976972 EPHA2 rs3754334 polymorphism is commonly associated with the risk for age-related cataract in different ethnic and geographical populations.
23951165 EphA2-induced angiogenesis in ewing sarcoma cells works through bFGF production and is dependent on caveolin-1.
23874206 Data suggest that EPHA2 regulates phosphorylation of clathrin, integrin signal transduction, polyubiquitination via proto-oncogene protein c-CBL, and endocytosis of Kaposi sarcoma-associated herpesvirus into fibroblasts.
23752181 EphA2 upregulation is a common event in gastric cancer specimens that is closely correlated with cancer metastasis.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
23661698 Findings suggest that the glycosylation on ephrin-A1 plays a critical role in the binding and activation of the EphA2 receptor.
23629968 Up-regulated MT1-MMP codistributes with and cleaves intracellular EphA2 in invasive cells within human breast carcinomas.
23588386 EPHA2 signaling contributed to tumor growth and vasculogenic mimicry of gallbladder carcinomas.
23318428 tyrosine phosphorylation of Shp2 by EphA2 contributes to the phosphatase-independent Shp2-mediated activation of Extracellular Signal-Regulated MAP Kinases and might be involved in Shp2-associated diseases.
23315987 growth factor-mediated EphA2 might be involved in cholangiocarcinoma growth and metastasis through activation of the mTORC1 and Raf/Pyk2 pathways
23298804 present study showed a high expression of EphA2/ephrinA1 in adenoid cystic carcinoma. EphA2/ephrinA1 can serve as a novel therapy target for adenoid cystic carcinoma.
23238013 The EphA2 receptor tyrosine kinase is overexpressed in hGBM TPCs.
23209418 Hsp90 inhibitors are efficacious against Kaposi Sarcoma by enhancing the degradation of the essential viral gene LANA, of the viral co-receptor EphA2 as well as other client proteins.
23037715 Arachidonic acid induced a rapid increase of EphA2 Akt-dependent/ligand-independent activation.
22635007 results identify EphA2, a tyrosine kinase with known functions in neovascularization and oncogenesis, as an entry receptor for Kaposi's sarcoma-associated herpesvirus
22570727 Our results provide the first report of multiple EPHA2 cataract mutations contributing to the destabilization of the receptor and causing the loss of cell migration activity.
22509030 Data show that EphA2 receptor acts as a regulator of Kaposi's sarcoma-associated herpesvirus (KSHV)-induced signal molecules and KSHV entry in endothelial cells and suggest that the EphA2 receptor is an attractive target for controlling KSHV infection.
22412971 Our results in the Indian population agree with previous studies of the association of EPHA2 variants with cortical cataracts.
22362770 analysis of structural and functional characterization of monomeric EphrinA1 binding site to EphA2 receptor
22332920 Sam (sterile alpha motif) domains of Odin, a member of the ANKS (ankyrin repeat and sterile alpha motif domain-containing) family of proteins, are important for the regulation of EphA2 endocytosis.
22261062 Ephrin-A1 activates EphA2 on the surface of MDA-MB-231 human breast cancer cells.
22256737 EphA2 is closely associated with the invasion, metastasis, angiogenesis and prognosis of nasopharyngeal carcinoma.
22236865 in p-stage I NSCLC patients, those in the higher EphA2 expression and higher ephrin-A1 expression groups shared almost the same clinicopathological backgrounds which are generally considered to be better prognostic factors.
22184117 loss of the regulation of this Eph pathway through HIC1 epigenetic silencing could be an important mechanism in the pathogenesis of epithelial cancers
22086185 Suppression of EphA2 resulted in a significant inhibition of proliferation, migration, invasion of SCCHN cells in vitro.
22009484 activation of EphA2 participates in the regulation of fallopian tube cell adhesion via FAK dephosphorylation
21955398 immunohistochemical analyses showed that high EPHA2 expression is detected in a subset of HNSCC tissues and is associated with poor prognosis
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21873938 The present data suggest that Eph-A2, but not Eph-A4, overexpression may be associated with the malignant transformation of thyroid neoplasia.
21737611 EPHA2 interacts with EPHB6 in breast tumor cell lines
21726568 EphA2 has a role in regulating both tight junction formation and angiogenesis in brain endothelial cells
21686326 Both SNP rs477558 and SNP rs7548209 of EPHA2 are associated with age-related cortical cataract in a Han Chinese population.
21666714 EphA2 is a critical oncogene in melanoma.
21575519 EphA2 protein expression is significantly increased in laryngeal squamous cell carcinoma tissues and cell lines, and overexpression is associated with tumor recurrence, metastasis and poorer prognosis in LSCC patients.
21538645 Human cytoplasmic protein tyrosine phosphatase-A and B exhibit distinct specificities for EPHA2 phosphotyrosines, which may provide a rationale for selective inhibitors necessary to investigate how HCPTP targets EPHA2 in transformed cells.
21516087 Identified epidermal growth factor receptor and ephrin receptor A2 as host cofactors for HCV entry. These receptor tyrosine kinases mediate HCV entry by regulating CD81-claudin-1 co-receptor associations and viral glycoprotein-dependent membrane fusion.
21500549 Ovarian serous carcinomas and ovarian cancer cell lines overexpress EphA2 and EphrinA-1. Tumor patients with higher expression levels of both EphA2 and EphrinA-1 have a significantly poorer clinical outcome.
21408136 A dual role for eHsp90 in transducing signaling via LRP1, and in facilitating LRP1 co-receptor function for EphA2, is reported.
21264258 EphA2 is a direct target of miR-26b, and the down-regulation of EphA2 mediated by miR-26b is dependent on the binding of miR-26b to a specific response element of microRNA in the 3'UTR region of EphA2 mRNA.
21205836 EphA2-overexpressing prostate carcinoma cells gain an invasive benefit from their amoeboid motility style to escape from primary tumors.
21166698 Osteosarcoma samples were characterized using genome-wide microarrays: increased expression of the EphA2 receptor and its ligand EFNA1 was detected.
20948320 of 85 endometrioid endometrial adenocarcinomas, EphA2 was overexpressed in 47% of tumors and was significantly associated with high VEGF expression and high microvessel density counts
20861311 Data show that desmoglein 1 expression was required for the adhesive effects of EphA2.
20837138 The activation of the EphA2 receptor tyrosine kinase can inhibit a major oncogenic signaling pathway, the Akt-mTORC1 pathway.
20679435 A novel link between EphA2 and Rac activation that contributes to the cell motility and invasiveness of breast cancer cells.
20614133 EphA2 may contribute to squamous-cell carcinoma of the head and neck (SCCHN) progression and represent a novel prognostic indicator for patients with SCCHN.
20602165 Our data demonstrate that dual targeting of EphA2 and ER is a promising approach for delaying resistance to Tamoxifen.
20571968 up-regulation of EphA2 and down-regulation of Ephrina1 may correlate with poor prognosis for patients with high-grade glioma
20516612 asymmetric unit is most likely to contain two 1C1 Fab-rEphA2 complexes
20388851 Data showed that EphA2 was expressed in the Hec-1A and Ishikawa cells but was absent in the SPEC-2 cells.
20361013 A missense mutation in EPHA2 associated with autosomal recessive congenital cataracts, is reported.
20360610 EphA2 mutation in lung squamous cell carcinoma promotes increased cell survival, cell invasion, focal adhesions, and mammalian target of rapamycin activation
20228801 Cell-surface expression of mutant EphA2s showed that these interfaces are critical for localization at cell-cell contacts and activation-dependent degradation
20223987 observations reveal a mechanism for spatio-mechanical regulation of EphA2 signaling pathways
20197042 Spatial structure of dimeric transmembrane domain of EphA2 receptor embedded into lipid bicelle was obtained by solution NMR, showing a left-handed parallel packing of the transmembrane helices.
20028874 EphA2 overexpression correlated with a decrease in disease-free and overall survival of HER2-overexpressing patients.
19950554 EphA2 and EphrinA1 are highly expressed in renal cell carcinoma, and positively correlated with histological differentiation, clinical stage and angiogenesis.
19949912 Eph-A2 expression was significantly associated with patients' age in pancreatic ductal adenocarcinoma
19948216 Adhesion-induced EphA2 expression is dependent upon activation of the epidermal growth factor receptor (EGFR), mitogen activated protein kinase kinase (MEK) and Src family kinases (SRC).
19934926 overexpression of EPHA2 and LAMC2, known to be important for the tube-forming capacity of melanoma tumor cells
19934338 Overexpression of the receptor tyrosine kinase EphA2 is associated with non-small cell lung cancer.
19898482 Observational study of gene-disease association. (HuGE Navigator)
19828693 EFNA4-EphA2 interactions are involved in Chronic lymphocytic leukemia cell trafficking between blood and the tissues
19724921 EPHA2 is one of the effectors of chemotherapeutic agents. EPHA2 expression may thus serve as a biomarker of drug responsiveness for neuroblastoma during the course of chemotherapy.
19690146 EphA2 represents a novel heat shock protein 90 client protein
19649315 Variants in EPHA2 showed significant association with cortical cataract.
19642143 EphA2 may be a useful serum marker for the detection of hepatocellular carinoma development and progression.
19531623 EphA2 expression in non small cell lung carcinoma is associated with K-Ras mutations, EGFR activation, smoking history, and poor prognosis.
19306328 Mutations of EPHA2 in three congenital cataracts families from different ancestral groups, are reported.
19264906 the kinase activity of EphA2 is required for the regulation of cell adhesion and cytoskeletal rearrangement, some distinct kinase-dependent and -independent pathways likely cooperate to drive cancer cell migration, invasion, and metastasis outcome.
19223760 Downregulation of EphA2 significantly inhibited invasion, proliferation and clonogenicity in vitro and suppressed tumorigenicity in vivo. Data provides the first in vivo evidence demonstrating a direct role for EphA2 in promoting melanoma tumorigenicity.
19193766 E-cadherin-based cell-cell contacts enhance EphA-ephrinA signaling, which in turn down-regulates Arf6 activity to enhance E-cadherin-based cell-cell contacts as well as the apical-basal polarization of epithelial cells.
19101799 EphA2 expression is an independent factor that indicates poor prognosis in postoperative gastric adenocarcinoma.
19074825 The function of EphA2 and ephrinA1 in tumorigenesis and tumor progression is complex and seems to be dependent on cell type and microenvironment
19048396 the over-expression of EphA2 or the down-expression of E-cadherin is correlated with cancer progression and lymphogenous metastasis in gastric cancer.
19005574 EPHA2, which functions in the Eph-ephrin bidirectional signaling pathway of mammalian cells, plays a vital role in maintaining lens transparency.
19005574 Observational study of gene-disease association. (HuGE Navigator)
18991394 NMR and ITC (isothermal titration calorimetry) studies on the Sam domain of Ship2 revealing its three-dimensional structure and its possible mode of interaction with the Sam domain from the EphA2 receptor
18768213 Receptor tyrosine kinase EphA2 mediates thrombin-induced upregulation of ICAM-1 in endothelial cells in vitro.
18648668 overexpression of HuR as found in many progressive tumors could be causative for disarranged Eph receptor to ephrin ligand ratios leading to a higher degree of tissue invasiveness
18566674 EphA2 and EphrinA-1 may play an important role in the development of a subset of early cervical cancers
18443431 EphA2 promotes tumor growth by enhancing cell-ECM adhesion, increasing anchorage-independent growth and promoting angiogenesis
18425361 EphA2 might be involved in the early development of HNSCC although not directly responsible for its progression
18210872 EPHA2 may be involoved in apoptosis and proliferation of osteosarcoma cells, and may be necessary for vasculogenic mimicry.
18198190 overexpression of a wild-type EPHA2, but not a signaling-defective cytoplasmic truncation mutant (DeltaC), in human mammary epithelial cells weakens E-cadherin-mediated cell-cell adhesion
18172271 IL-13R alpha 2, EphA2, and Fra-1 are attractive therapeutic targets representing molecular denominators of high-grade astrocytomas. One hundred percent of GBM tumors overexpress at least one of these proteins.
18097589 this study define the expression pattern of EphA2 in both primary and recurrent glioblastoma and suggest an important role of EphA2 in the pathogenesis of GBM.
18079969 EphA2 cooperates with ErbB2 to promote tumor progression in mice and may provide a novel therapeutic target for ErbB2-dependent tumors in humans.
18059341 Required for Raf-induced AKT inhibition and cell cycle arrest.
17980912 Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions.
17519535 EphA2 may be a new biomarker for astrocytic tumors and may also affect the proliferation and apoptosis of tumor cells and be an attractive therapy target for astrocytic tumors.
17374733 Ligand activation of EphA2 and EphA2 knockdown by small interfering RNA inhibit EGF-induced cell motility of EGFR-overexpressing human cancer cells, indicating a functional role of EphA2 in EGFR-expressing cancer cells.
17332925 Ephrin-A1 serves as a critical negative regulator in the tumorigenesis of gliomas by down-regulating EphA2 and FAK.
17154180 EphA2 was overexpressed in 76% of tumors and was associated with advanced-stage disease and high-grade histology.
17050670 Our findings show that p53 is a transcriptional regulator of ECK in mediating apoptosis. The discovery of the novel p53-binding motif in the promoter may lead to the identification of a new class of p53 target genes.
16969087 p53 appears to regulate EphA2 expression and clinical outcome in ovarian cancer.
16737551 increased levels of ephrins A1 and A5 in the presence of high expression of Ephs A1 and A2 lead to a more aggressive ovarian cancer phenotype
16481735 VE-cadherin and EphA2 act in a coordinated manner as a key regulatory element in the process of melanoma vasculogenic mimicry.
16428472 High expression of EphA2 is associated with urinary bladder carcinoma.
16236711 EphA2 moderates the function of tight junctions via phosphorylation of claudin-4
16103880 receptor phosphorylation and kinase activity of the EphA2 receptor, at least in part, contribute to tumor malignancy
16098464 EphA2 attenuates the growth factor-induced activation of Ras and a negative feedback loop is created that regulates Ras activity.
16051609 low molecular weight protein-tyrosine phosphatase acts as terminator of EphA2 signaling causing efficient negative feedback loop on biological response mediated by ephrinA1; tyrosine phosphorylation main event orchestrating repulsive response
15671550 EphA2 may have a role in progression of surgically treated renal cell carcinoma
15649254 EPHA2 and EFNA1 expression may influence the behavior of human gastric cancer.
15561974 Renal medullary EphA2 expression may represent an adaptive response to medullary hypertonicity or urea exposure
15498927 EphA2 selectively inhibits cell-cell adhesions by increasing cell attachment and up-regulating the extracellular matrix protein fibronectin
15297418 EPHA2 may have a role in progression of ovarian cancer
15249202 We show that EphA2 overexpression induces a FAK-dependent increase in MMP-2 expression and invasiveness.
15193868 found the prototype ephrin-A1 receptor, EphA2, localized in several placental cell types
14965363 involvement of EPHA2 in colon carcinogenesis, mainly in stages I and II, and probably through their effect on microvessel induction.
14767510 EphA2 and E-cadherin may play an important role in tumor metastasis in colorectal cancer
14679012 EphA2 is a tumor rejection antigen. Two immunogenic HLA-A*0201 restricted peptides identified by reverse immunology approach.
14633601 EphA2 increases as prostatic epithelial cells have more aggressive phenotype. EphA2 functions as a powerful oncogene. Presence of high levels of EphA2 suggests opportunities for prostate cancer prevention and treatment.
12907451 EphA2/ephrin-A3 interactions may play a role in the localization and network of Langerhans cells in the epithelium and in the regulation of their trafficking.
12810680 Overexpression of EphA2 decreases estrogen dependence. EphA2-transfected cells show increased growth in vitro & larger & more aggressive tumors in vivo. Overexpression decreases tamoxifen's ability to inhibit breast cancer cell growth & tumorigenesis.
12651595 differentially regulated in normal and malignant cells.
12650608 Recent studies have demonstrated that the EphA2 receptor tyrosine kinase is frequently overexpressed and functionally altered in aggressive tumor cells, and that these changes promote metastatic character
12576426 Levels predict lung cancer (NSCLC) recurrence and survival.
12496371 c-Cbl-dependent EphA2 protein degradation is induced by ligand binding.
12496364 Blockade of EphA2 activation inhibits vascular endothelial growth factor-induced angiogenesis.
12494475 Patients with EphA2 overexpression have a poorer prognosis than those without.
12400011 We demonstrate that tyrosine phosphorylated EphA2 interacts with the PTB and SH2 domains of SHC. We show that the interaction of EphA2 with GRB2 is mediated by SHC and that this complex is necessary for EphA2-mediated activation of ERK kinases.
12370823 Eph A receptors inhibit tumor angiogenesis and progression in vivo.
12351647 a peptide has been identified which has ephrin-like activity in that it stimulates EphA2 tyrosine phosphorylation and signaling
12167657 EphA2 receptor tyrosine kinase is a substrate for low molecular weight tyrosine phosphatase and has a role in neoplastic transformation progression
12147253 negative regulation by Cbl
11968011 estrogen and Myc negatively regulate EphA2 expression in mammary epithelial cells

AA Sequence

MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVC      1 - 70
NVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFT     71 - 140
KIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAH    141 - 210
FPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGF    211 - 280
FKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTP    281 - 350
PQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG    351 - 420
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGF    421 - 490
SVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHR    491 - 560
RRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKG    561 - 630
MLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGAL    631 - 700
DKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEA    701 - 770
TYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM    771 - 840
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVS    841 - 910
EWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI        911 - 976
//

Text Mined References (228)

PMID Year Title
27385333 2016 Protein kinase A can block EphA2 receptor-mediated cell repulsion by increasing EphA2 S897 phosphorylation.
26900323 2016 EPHA2 MUTATIONS CONTRIBUTE TO CONGENITAL CATARACT THROUGH DIVERSE MECHANISMS.
26843134 2016 MicroRNA-26b Enhances the Radiosensitivity of Hepatocellular Carcinoma Cells by Targeting EphA2.
26744526 2016 EPHA2 Blockade Overcomes Acquired Resistance to EGFR Kinase Inhibitors in Lung Cancer.
26722543 2015 Expression of EphA2 protein is positively associated with age, tumor size and Fuhrman nuclear grade in clear cell renal cell carcinomas.
26565750 2015 EphA2 promotes cell adhesion and spreading of monocyte and monocyte/macrophage cell lines on integrin ligand-coated surfaces.
26363067 2015 EphA2 Receptor Unliganded Dimers Suppress EphA2 Pro-tumorigenic Signaling.
26283684 2016 EphA2 Expression Is a Key Driver of Migration and Invasion and a Poor Prognostic Marker in Colorectal Cancer.
26191168 2015 MiR-26b inhibits hepatocellular carcinoma cell proliferation, migration, and invasion by targeting EphA2.
26177500 2015 EphA2 Is a Potential Player of Malignant Cellular Behavior in Non-Metastatic Renal Cell Carcinoma Cells but Not in Metastatic Renal Cell Carcinoma Cells.
26158630 2015 Crucial roles of RSK in cell motility by catalysing serine phosphorylation of EphA2.
26130649 2015 Proteolysis of EphA2 Converts It from a Tumor Suppressor to an Oncoprotein.
26120079 2015 Peptide Fragments of Odin-Sam1: Conformational Analysis and Interaction Studies with EphA2-Sam.
26088362 2015 miR-200a inhibits migration of triple-negative breast cancer cells through direct repression of the EPHA2 oncogene.
25906164 2015 EphrinA2 receptor (EphA2) is an invasion and intracellular signaling receptor for Chlamydia trachomatis.
25613580 2015 A dysregulated microRNA-26a/EphA2 axis impairs endothelial progenitor cell function via the p38 MAPK/VEGF pathway.
25542448 2015 EPHA2 is a mediator of vemurafenib resistance and a novel therapeutic target in melanoma.
25542447 2015 Ligand-independent EPHA2 signaling drives the adoption of a targeted therapy-mediated metastatic melanoma phenotype.
25478832 2014 Structures of an Eph receptor tyrosine kinase and its potential activation mechanism.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25366905 2015 Phosphotyrosine profiling identifies ephrin receptor A2 as a potential therapeutic target in esophageal squamous-cell carcinoma.
25344320 2014 Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through ?-catenin.
25310629 2014 Geldanamycin mediates the apoptosis of gastric carcinoma cells through inhibition of EphA2 protein expression.
25281742 2014 The Eph tyrosine kinase receptors EphB2 and EphA2 are novel proteolytic substrates of tissue factor/coagulation factor VIIa.
25239188 2014 EphB6 promotes anoikis by modulating EphA2 signaling.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
25063221 2014 MicroRNA 520d-3p inhibits gastric cancer cell proliferation, migration, and invasion by downregulating EphA2 expression.
25023279 2014 Transactivation of the receptor-tyrosine kinase ephrin receptor A2 is required for the low molecular weight hyaluronan-mediated angiogenesis that is implicated in tumor progression.
24969670 2014 Association between ephrin-A1 mRNA expression and poor prognosis after hepatectomy to treat hepatocellular carcinoma.
24940039 2014 Identification of a novel C-terminal extension mutation in EPHA2 in a family affected with congenital cataract.
24908114 2015 Overexpression of Ephrin A2 receptors in cancer stromal cells is a prognostic factor for the relapse of gastric cancer.
24899181 2014 Binding of the Kaposi's sarcoma-associated herpesvirus to the ephrin binding surface of the EphA2 receptor and its inhibition by a small molecule.
24864260 2014 Epithelial-mesenchymal transition regulated by EphA2 contributes to vasculogenic mimicry formation of head and neck squamous cell carcinoma.
24853748 2014 Spatial organization of EphA2 at the cell-cell interface modulates trans-endocytosis of ephrinA1.
24825902 2014 Binding and function of phosphotyrosines of the Ephrin A2 (EphA2) receptor using synthetic sterile ? motif (SAM) domains.
24733396 2014 Point mutations in dimerization motifs of the transmembrane domain stabilize active or inactive state of the EphA2 receptor tyrosine kinase.
24717580 2014 Tobacco smoke induces epithelial barrier dysfunction via receptor EphA2 signaling.
24713656 2014 Genetic and pharmacologic inhibition of EPHA2 promotes apoptosis in NSCLC.
24673449 2016 EPHA2 Polymorphisms in Estonian Patients with Age-Related Cataract.
24647573 2014 miR-141 is a key regulator of renal cell carcinoma proliferation and metastasis by controlling EphA2 expression.
24607842 2014 JNK signaling mediates EPHA2-dependent tumor cell proliferation, motility, and cancer stem cell-like properties in non-small cell lung cancer.
24503792 Increased expression of EphA2 and E-N cadherin switch in primary hepatocellular carcinoma.
24488013 2015 EphA2 promotes infiltrative invasion of glioma stem cells in vivo through cross-talk with Akt and regulates stem cell properties.
24486585 2014 Cross-talk between EphA2 and BRaf/CRaf is a key determinant of response to Dasatinib.
24458982 2014 VEGF increases paracellular permeability in brain endothelial cells via upregulation of EphA2.
24457997 2014 SLAP displays tumour suppressor functions in colorectal cancer via destabilization of the SRC substrate EPHA2.
24285539 2014 Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells.
24141256 2013 Age-associated defects in EphA2 signaling impair the migration of human cardiac progenitor cells.
24064975 2013 Surface proteomic analysis of osteosarcoma identifies EPHA2 as receptor for targeted drug delivery.
24014202 2013 Mutations in the EPHA2 gene are a major contributor to inherited cataracts in South-Eastern Australia.
23976972 2013 Association of the ephreceptor tyrosinekinase-type A2 (EPHA2) gene polymorphism rs3754334 with age-related cataract risk: a meta-analysis.
23951165 2013 EphA2-induced angiogenesis in ewing sarcoma cells works through bFGF production and is dependent on caveolin-1.
23936024 2013 Early insights into the function of KIAA1199, a markedly overexpressed protein in human colorectal tumors.
23874206 2013 EphrinA2 regulates clathrin mediated KSHV endocytosis in fibroblast cells by coordinating integrin-associated signaling and c-Cbl directed polyubiquitination.
23752181 2014 EphA2 promotes epithelial-mesenchymal transition through the Wnt/?-catenin pathway in gastric cancer cells.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23661698 2013 Biological and structural characterization of glycosylation on ephrin-A1, a preferred ligand for EphA2 receptor tyrosine kinase.
23629968 2013 EphA2 cleavage by MT1-MMP triggers single cancer cell invasion via homotypic cell repulsion.
23588386 2013 Contribution of the PI3K/MMPs/Ln-5?2 and EphA2/FAK/Paxillin signaling pathways to tumor growth and vasculogenic mimicry of gallbladder carcinomas.
23358419 2013 Receptor protein tyrosine phosphatase-receptor tyrosine kinase substrate screen identifies EphA2 as a target for LAR in cell migration.
23318428 2013 Involvement of EphA2-mediated tyrosine phosphorylation of Shp2 in Shp2-regulated activation of extracellular signal-regulated kinase.
23315987 2013 Activation of mammalian target of rapamycin complex 1 (mTORC1) and Raf/Pyk2 by growth factor-mediated Eph receptor 2 (EphA2) is required for cholangiocarcinoma growth and metastasis.
23298804 2013 EphA2/ephrinA1 mRNA expression and protein production in adenoid cystic carcinoma of salivary gland.
23238013 2012 The EphA2 receptor drives self-renewal and tumorigenicity in stem-like tumor-propagating cells from human glioblastomas.
23209418 2012 Hsp90 inhibitors are efficacious against Kaposi Sarcoma by enhancing the degradation of the essential viral gene LANA, of the viral co-receptor EphA2 as well as other client proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23037715 2012 Ligand-independent activation of EphA2 by arachidonic acid induces metastasis-like behaviour in prostate cancer cells.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22635007 2012 The ephrin receptor tyrosine kinase A2 is a cellular receptor for Kaposi's sarcoma–associated herpesvirus.
22570727 2012 Human cataract mutations in EPHA2 SAM domain alter receptor stability and function.
22509030 2012 Kaposi's sarcoma-associated herpesvirus interacts with EphrinA2 receptor to amplify signaling essential for productive infection.
22412971 2012 EPHA2 polymorphisms and age-related cataract in India.
22362770 2012 Structural and functional characterization of monomeric EphrinA1 binding site to EphA2 receptor.
22332920 2012 Solution structure of the first Sam domain of Odin and binding studies with the EphA2 receptor.
22261062 2011 EphA2 receptor activation by monomeric Ephrin-A1 on supported membranes.
22256737 2011 [The expression and its potentially clinical significance of EphA2 in nasopharyngeal carcinoma].
22236865 2012 Higher expression of EphA2 and ephrin-A1 is related to favorable clinicopathological features in pathological stage I non-small cell lung carcinoma.
22184117 2012 The receptor tyrosine kinase EphA2 is a direct target gene of hypermethylated in cancer 1 (HIC1).
22086185 2012 Downregulation of EphA2 expression suppresses the growth and metastasis in squamous-cell carcinoma of the head and neck in vitro and in vivo.
22036564 2011 The Eph-receptor A7 is a soluble tumor suppressor for follicular lymphoma.
22009484 2012 Activation of erythropoietin-producing hepatocellular receptor A2 attenuates cell adhesion of human fallopian tube epithelial cells via focal adhesion kinase dephosphorylation.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21955398 2011 Quantitative chemical proteomics reveals new potential drug targets in head and neck cancer.
21935409 2011 Eph/ephrin profiling in human breast cancer reveals significant associations between expression level and clinical outcome.
21873938 2011 Eph-A2 and Eph-A4 expression in human benign and malignant thyroid lesions: an immunohistochemical study.
21737611 A paradigm shift in EPH receptor interaction: biological relevance of EPHB6 interaction with EPHA2 and EPHB2 in breast carcinoma cell lines.
21726568 2011 Inactivation of EphA2 promotes tight junction formation and impairs angiogenesis in brain endothelial cells.
21686326 2011 Association of EPHA2 polymorphisms and age-related cortical cataract in a Han Chinese population.
21666714 2011 EphA2 is a critical oncogene in melanoma.
21575519 2011 [Correlation of EphA2 protein expression with clinicopathological characteristics and prognosis in laryngeal squamous cell carcinoma].
21538645 2011 Specificity of HCPTP variants toward EphA2 tyrosines by quantitative selected reaction monitoring.
21516087 2011 EGFR and EphA2 are host factors for hepatitis C virus entry and possible targets for antiviral therapy.
21500549 2011 [Expression and prognostic significance of EphA2 and EphrinA-1 in ovarian serous carcinomas].
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21408136 2011 A novel extracellular Hsp90 mediated co-receptor function for LRP1 regulates EphA2 dependent glioblastoma cell invasion.
21269460 2011 Initial characterization of the human central proteome.
21264258 2011 Role of microRNA-26b in glioma development and its mediated regulation on EphA2.
21205836 2011 EphA2 induces metastatic growth regulating amoeboid motility and clonogenic potential in prostate carcinoma cells.
21166698 2010 De novo expression of EphA2 in osteosarcoma modulates activation of the mitogenic signalling pathway.
20948320 2010 Clinical and biological impact of EphA2 overexpression and angiogenesis in endometrial cancer.
20861311 2010 Ligand targeting of EphA2 enhances keratinocyte adhesion and differentiation via desmoglein 1.
20837138 2011 Crosstalk of the EphA2 receptor with a serine/threonine phosphatase suppresses the Akt-mTORC1 pathway in cancer cells.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
20614133 2011 Clinical significance of EphA2 expression in squamous-cell carcinoma of the head and neck.
20602165 2011 Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer.
20571968 2010 Up-regulation of EphA2 and down-regulation of EphrinA1 are associated with the aggressive phenotype and poor prognosis of malignant glioma.
20516612 2010 Crystallization and preliminary X-ray diffraction analysis of the complex of a human anti-ephrin type-A receptor 2 antibody fragment and its cognate antigen.
20505120 2010 Architecture of Eph receptor clusters.
20388851 2010 EphA2 targeted chemotherapy using an antibody drug conjugate in endometrial carcinoma.
20361013 2010 Autosomal recessive congenital cataract linked to EPHA2 in a consanguineous Pakistani family.
20360610 2010 EphA2 mutation in lung squamous cell carcinoma promotes increased cell survival, cell invasion, focal adhesions, and mammalian target of rapamycin activation.
20228801 2010 An extracellular steric seeding mechanism for Eph-ephrin signaling platform assembly.
20223987 2010 Restriction of receptor movement alters cellular response: physical force sensing by EphA2.
20197042 2010 Left-handed dimer of EphA2 transmembrane domain: Helix packing diversity among receptor tyrosine kinases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20028874 2010 Elevation of receptor tyrosine kinase EphA2 mediates resistance to trastuzumab therapy.
19950554 2009 [Expression of EphA2 and EphrinA1 in human renal cell carcinoma and its relationship with angiogenesis].
19949912 2010 Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma.
19948216 2010 Cell adhesion and EGFR activation regulate EphA2 expression in cancer.
19934926 2009 Prognostic role of vasculogenic mimicry in colorectal cancer.
19934338 2009 EphA2 in the early pathogenesis and progression of non-small cell lung cancer.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19828693 2009 An impaired transendothelial migration potential of chronic lymphocytic leukemia (CLL) cells can be linked to ephrin-A4 expression.
19724921 2009 Biological significance of EPHA2 expression in neuroblastoma.
19690146 2009 Heat shock protein 90 inhibitor 17-dimethylaminoethylamino-17-demethoxygeldanamycin enhances EphA2+ tumor cell recognition by specific CD8+ T cells.
19649315 2009 EPHA2 is associated with age-related cortical cataract in mice and humans.
19642143 2010 EFNA1 ligand and its receptor EphA2: potential biomarkers for hepatocellular carcinoma.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19573808 2009 EphA2 mediates ligand-dependent inhibition and ligand-independent promotion of cell migration and invasion via a reciprocal regulatory loop with Akt.
19567782 2009 Hsp90 is an essential regulator of EphA2 receptor stability and signaling: implications for cancer cell migration and metastasis.
19531623 2009 Expression of the receptor tyrosine kinase EphA2 is increased in smokers and predicts poor survival in non-small cell lung cancer.
19525919 2009 Ligand recognition by A-class Eph receptors: crystal structures of the EphA2 ligand-binding domain and the EphA2/ephrin-A1 complex.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19306328 2009 Mutations of the EPHA2 receptor tyrosine kinase gene cause autosomal dominant congenital cataract.
19264906 2009 Kinase-dependent and -independent roles of EphA2 in the regulation of prostate cancer invasion and metastasis.
19223760 2009 EphA2 as a promoter of melanoma tumorigenicity.
19193766 2009 EphA2 engages Git1 to suppress Arf6 activity modulating epithelial cell-cell contacts.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19101799 2009 Over-expression of EphA2 and EphrinA-1 in human gastric adenocarcinoma and its prognostic value for postoperative patients.
19074825 2008 The EphA2 receptor and ephrinA1 ligand in solid tumors: function and therapeutic targeting.
19048396 2009 Expression of EphA2 and E-cadherin in gastric cancer: correlated with tumor progression and lymphogenous metastasis.
19005574 2008 The EPHA2 gene is associated with cataracts linked to chromosome 1p.
18991394 2008 NMR studies of a heterotypic Sam-Sam domain association: the interaction between the lipid phosphatase Ship2 and the EphA2 receptor.
18794797 2008 Soluble monomeric EphrinA1 is released from tumor cells and is a functional ligand for the EphA2 receptor.
18768213 2009 Receptor tyrosine kinase EphA2 mediates thrombin-induced upregulation of ICAM-1 in endothelial cells in vitro.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18648668 2008 Comparative 3'UTR analysis allows identification of regulatory clusters that drive Eph/ephrin expression in cancer cell lines.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18566674 2008 Expressions of EphA2 and EphrinA-1 in early squamous cell cervical carcinomas and their relation to prognosis.
18443431 2008 EphA2 overexpression promotes ovarian cancer growth.
18425361 2008 Involvement of EphA2 in head and neck squamous cell carcinoma: mRNA expression, loss of heterozygosity and immunohistochemical studies.
18339848 2008 EphA2 is an essential mediator of UV radiation-induced apoptosis.
18210872 2007 [Effect of EPHA2-siRNA plasmid on biological behavior of human osteosarcoma cells in vitro].
18198190 2008 Overexpression of EPHA2 receptor destabilizes adherens junctions via a RhoA-dependent mechanism.
18172271 2008 Interleukin-13 receptor alpha 2, EphA2, and Fos-related antigen 1 as molecular denominators of high-grade astrocytomas and specific targets for combinatorial therapy.
18097589 2008 Increased expression of EphA2 correlates with adverse outcome in primary and recurrent glioblastoma multiforme patients.
18079969 2008 The receptor tyrosine kinase EphA2 promotes mammary adenocarcinoma tumorigenesis and metastatic progression in mice by amplifying ErbB2 signaling.
18059341 2008 Constitutive activation of the Raf-MAPK pathway causes negative feedback inhibition of Ras-PI3K-AKT and cellular arrest through the EphA2 receptor.
17980912 2008 EphA and ephrin-A proteins regulate integrin-mediated T lymphocyte interactions.
17519535 2007 Expression of EphA2 in human astrocytic tumors: correlation with pathologic grade, proliferation and apoptosis.
17374733 2007 Activation of the EGFR gene target EphA2 inhibits epidermal growth factor-induced cancer cell motility.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17332925 2007 Ephrin-A1 is a negative regulator in glioma through down-regulation of EphA2 and FAK.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17154180 2007 EphA2 overexpression is associated with angiogenesis in ovarian cancer.
17135240 2007 Regulation of EphA2 receptor endocytosis by SHIP2 lipid phosphatase via phosphatidylinositol 3-Kinase-dependent Rac1 activation.
17050670 2006 A novel mechanism for p53 to regulate its target gene ECK in signaling apoptosis.
16969087 2006 Analysis of EphA2 expression and mutant p53 in ovarian carcinoma.
16737551 2006 Over-expression of Eph and ephrin genes in advanced ovarian cancer: ephrin gene expression correlates with shortened survival.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16481735 2006 VE-cadherin regulates EphA2 in aggressive melanoma cells through a novel signaling pathway: implications for vasculogenic mimicry.
16428472 2006 Expression of EphA2 and Ephrin A-1 in carcinoma of the urinary bladder.
16236711 2005 EphA2 phosphorylates the cytoplasmic tail of Claudin-4 and mediates paracellular permeability.
16103880 2005 A kinase-dependent role for EphA2 receptor in promoting tumor growth and metastasis.
16098464 2005 A conditional feedback loop regulates Ras activity through EphA2.
16051609 2005 EphrinA1 repulsive response is regulated by an EphA2 tyrosine phosphatase.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15777695 2005 Characterization of a novel Eph receptor tyrosine kinase, EphA10, expressed in testis.
15671550 2005 Expression of EphA2 is prognostic of disease-free interval and overall survival in surgically treated patients with renal cell carcinoma.
15649254 2005 EPHA2/EFNA1 expression in human gastric cancer.
15561974 2005 EphA2: expression in the renal medulla and regulation by hypertonicity and urea stress in vitro and in vivo.
15498927 2004 EphA2 induction of fibronectin creates a permissive microenvironment for malignant cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297418 2004 EphA2 expression is associated with aggressive features in ovarian carcinoma.
15249202 2004 Ligation of EphA2 by Ephrin A1-Fc inhibits pancreatic adenocarcinoma cellular invasiveness.
15193868 2004 Eph and ephrin expression in normal placental development and preeclampsia.
14965363 2004 Correlation of EPHA2 overexpression with high microvessel count in human primary colorectal cancer.
14767510 2004 Expression of EphA2 and E-cadherin in colorectal cancer: correlation with cancer metastasis.
14679012 2003 EphA2 as target of anticancer immunotherapy: identification of HLA-A*0201-restricted epitopes.
14633601 2003 High-level expression of EphA2 receptor tyrosine kinase in prostatic intraepithelial neoplasia.
12907451 2003 Human dendritic cells express neuronal Eph receptor tyrosine kinases: role of EphA2 in regulating adhesion to fibronectin.
12810680 2003 EphA2 overexpression decreases estrogen dependence and tamoxifen sensitivity.
12651595 2003 Differential regulation of EphA2 in normal and malignant cells.
12650608 2003 Overexpression and functional alterations of the EphA2 tyrosine kinase in cancer.
12576426 2003 Predictive value of the EphA2 receptor tyrosine kinase in lung cancer recurrence and survival.
12496371 2002 c-Cbl-dependent EphA2 protein degradation is induced by ligand binding.
12496364 2002 Blockade of EphA receptor tyrosine kinase activation inhibits vascular endothelial cell growth factor-induced angiogenesis.
12494475 2003 EphA2 overexpression correlates with poor prognosis in esophageal squamous cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12467573 2002 Structures of the cancer-related Aurora-A, FAK, and EphA2 protein kinases from nanovolume crystallography.
12400011 2002 Activation of the EphA2 tyrosine kinase stimulates the MAP/ERK kinase signaling cascade.
12370823 2002 Soluble Eph A receptors inhibit tumor angiogenesis and progression in vivo.
12351647 2002 An ephrin mimetic peptide that selectively targets the EphA2 receptor.
12167657 2002 Regulation of the EphA2 kinase by the low molecular weight tyrosine phosphatase induces transformation.
12147253 2002 Negative regulation of EphA2 receptor by Cbl.
11968011 2002 Estrogen and Myc negatively regulate expression of the EphA2 tyrosine kinase.
11280802 2001 EphA2 overexpression causes tumorigenesis of mammary epithelial cells.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11146556 2000 The ephrin-A1 ligand and its receptor, EphA2, are expressed during tumor neovascularization.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10655584 2000 Activation of EphA2 kinase suppresses integrin function and causes focal-adhesion-kinase dephosphorylation.
10607706 2000 A splice variant of human ephrin-A4 encodes a soluble molecule that is secreted by activated human B lymphocytes.
10502115 1999 Signal transfer by eph receptors
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9245480 1997 LERK-7: a ligand of the Eph-related kinases is developmentally regulated in the brain.
9119409 1997 ECK, a human EPH-related gene, maps to 1p36.1, a common region of alteration in human cancers.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8183555 1994 The Eck receptor tyrosine kinase is implicated in pattern formation during gastrulation, hindbrain segmentation and limb development.
7982920 1994 Activation of the Eck receptor protein tyrosine kinase stimulates phosphatidylinositol 3-kinase activity.
7973638 1994 Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.
7543898 1995 Characterization of a novel Src-like adapter protein that associates with the Eck receptor tyrosine kinase.
7536959 1995 Role of B61, the ligand for the Eck receptor tyrosine kinase, in TNF-alpha-induced angiogenesis.
2174105 1990 cDNA cloning and characterization of eck, an epithelial cell receptor protein-tyrosine kinase in the eph/elk family of protein kinases.