Property Summary

NCBI Gene PubMed Count 55
PubMed Score 1129.83
PubTator Score 76.76

Knowledge Summary

Patent (54,104)

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.100 5.0e-02
psoriasis 2.100 2.8e-04

 CSPA Cell Line (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (34)

PMID Text
26977017 EPHA1 suppresses spreading and adhesion of HRT18 colorectal cancer cells through deactivation of ERK and JNK signaling pathways.
26261568 Data indicate that EphA1 protein may be a new marker for the prognosis of clear cell renal cell carcinoma.
25451169 EphrinA1 plays an important role in the TNF-alpha-mediated adhesion of monocytes to endothelial cells.
25391265 High expression of EphA1 was associated with metastasis and recurrence in Gastric Cancer.
25286141 two states of the EphA1 transmembrane helix dimer
25182741 This study suggests EPHA1 (rs11771145) interferes with the pathological alteration of the hippocampus and the lateral occipitotemporal and inferior temporal gyri throughout the Alzheimer's disease process, leading to a lower risk of Alzheimer's disease.
25025847 Lack of ephrin receptor A1 is a favorable independent prognostic factor in clear cell renal cell carcinoma.
24040450 Suggest EphA1 receptor may have roles in carcinogenesis and progression of prostate cancer.
23429488 High Eph A1 expression is associated with choriocarcinoma invasion.
23030051 Results show that EphA1 appears to be a differentiation marker for esophageal squamous cells, and its increased expression is positively associated with lymph node metastasis and advanced disease stage.
22688511 EphrinA1 is released in three forms from cancer cells by matrix metalloproteases
22362770 analysis of structural and functional characterization of monomeric EphrinA1 binding site to EphA2 receptor
22261062 Ephrin-A1 activates EphA2 on the surface of MDA-MB-231 human breast cancer cells.
21503576 The present study reveals a novel function for EphA1 and EphB2 in the induction of autophagy, suggesting a tumor suppressor role for these proteins in colorectal cancer.
21460841 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21460840 found independent evidence for association for Alzheimer's disease susceptibility loci at EPHA1, CD33 and CD2AP
21042754 The EphA1 expression level is a potential prognostic marker in gastric carcinoma, and may provide a novel target of therapy for gastric carcinoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20043122 Suppression of EphA1 expression in Huh-7 cells reduced their outgrowth when inoculated in the subcutaneous space in the flank of nude mice, presumably through angiogenesis inhibition since microvessel density was found to be inhibited.
19949912 Eph-A1 staining intensity was significantly associated with tumor size and tumor histopathological stage in pancreatic ductal adenocarcinoma
19913121 Observational study of gene-disease association. (HuGE Navigator)
19525919 The crystal structures of an A-class complex between EphA2 and ephrin-A1 and of unbound EphA2, are presented.
19277044 Epigenetic silencing of EphA1 expression in colorectal cancer is correlated with poor survival.
19118217 EphA1 regulates cell morphology and motility through the ILK-RhoA-ROCK pathway.
19011600 EphA1 may play different roles during the different stages of colorectal carcinoma progression.
18990944 We report selective targeting of PC-3 cells with nanoshells conjugated to ephrinA I, a ligand for EphA2 receptor that is overexpressed on PC-3 cells.
18802966 In EphA1 null transgenic mice a possible role for EphA1 in tissue patterning and hormone-induced apoptotic processes is indicated.
18728013 analysis of the spatial structure and pH-dependent conformational diversity of dimeric transmembrane domain of the receptor tyrosine kinase EphA1
18590698 Results suggest that EphA1-receptor transmembrane domains contribute to the dimerization-mediated receptor activation.
18566674 EphA2 and EphrinA-1 may play an important role in the development of a subset of early cervical cancers
18308734 I 12 acquired a higher affinity toward EphA2 with K(d) 18 nm and inhibited vascular endothelial growth factor-dependent angiogenic invasion in a Matrigel plug assay
17980912 Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions.
16862074 EphA1 seems to be a marker of the differentiated normal epidermis and its downregulation in nonmelanoma skin cancer may contribute to carcinogenesis of these very frequent human tumors.
16737551 increased levels of ephrins A1 and A5 in the presence of high expression of Ephs A1 and A2 lead to a more aggressive ovarian cancer phenotype

AA Sequence

MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCP      1 - 70
MQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRP     71 - 140
LFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNG    141 - 210
LAQFPDTLPGPAGLVEVAGTCLPHARASPRPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVAC    211 - 280
PSGSYRMDMDTPHCLTCPQQSTAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSL    281 - 350
RWEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE    351 - 420
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDE    421 - 490
ERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVSRGLTGGEIVAVIFGLLLGAA    491 - 560
LLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYVDLQAYEDPAQGALDFTRELDPAWLMVDTVI    561 - 630
GEGEFGEVYRGTLRLPSQDCKTVAIKTLKDTSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMI    631 - 700
ITEFMENGALDAFLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGL    701 - 770
TRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE    771 - 840
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRMTLRLPSLSGS    841 - 910
DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGFKD        911 - 976
//

Text Mined References (62)

PMID Year Title
26977017 2016 Knockdown of EPHA1 by CRISPR/CAS9 Promotes Adhesion and Motility of HRT18 Colorectal Carcinoma Cells.
26261568 2015 Expression of the EphA1 protein is associated with Fuhrman nuclear grade in clear cell renal cell carcinomas.
25451169 2014 TNF-?-mediated adhesion of monocytes to endothelial cells-The role of ephrinA1.
25391265 2015 Erythropoietin-Producing Hepatocellular A1 is an Independent Prognostic Factor for Gastric Cancer.
25286141 2014 Dimerization of the EphA1 receptor tyrosine kinase transmembrane domain: Insights into the mechanism of receptor activation.
25182741 2015 Effect of EPHA1 genetic variation on cerebrospinal fluid and neuroimaging biomarkers in healthy, mild cognitive impairment and Alzheimer's disease cohorts.
25025847 2014 Lack of ephrin receptor A1 is a favorable independent prognostic factor in clear cell renal cell carcinoma.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24040450 2013 Increased expression of EphA1 protein in prostate cancers correlates with high Gleason score.
23429488 2013 Eph-ephrin A system regulates human choriocarcinoma-derived JEG-3 cell invasion.
23030051 2013 High expression of EphA1 in esophageal squamous cell carcinoma is associated with lymph node metastasis and advanced disease.
22688511 2012 EphrinA1 is released in three forms from cancer cells by matrix metalloproteases.
22362770 2012 Structural and functional characterization of monomeric EphrinA1 binding site to EphA2 receptor.
22261062 2011 EphA2 receptor activation by monomeric Ephrin-A1 on supported membranes.
21503576 2011 Sesamin induces autophagy in colon cancer cells by reducing tyrosine phosphorylation of EphA1 and EphB2.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21460840 2011 Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21042754 2010 Expression of EphA1 in gastric carcinomas is associated with metastasis and survival.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20043122 2010 EphA1 receptor silencing by small interfering RNA has antiangiogenic and antitumor efficacy in hepatocellular carcinoma.
19949912 2010 Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19525919 2009 Ligand recognition by A-class Eph receptors: crystal structures of the EphA2 ligand-binding domain and the EphA2/ephrin-A1 complex.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19277044 2009 Epigenetic silencing of EphA1 expression in colorectal cancer is correlated with poor survival.
19118217 2009 EphA1 interacts with integrin-linked kinase and regulates cell morphology and motility.
19011600 2009 Downregulation of EphA1 in colorectal carcinomas correlates with invasion and metastasis.
18990944 2008 EphrinA I-targeted nanoshells for photothermal ablation of prostate cancer cells.
18802966 2008 Generation and characterization of EphA1 receptor tyrosine kinase reporter knockout mice.
18728013 2008 Spatial structure and pH-dependent conformational diversity of dimeric transmembrane domain of the receptor tyrosine kinase EphA1.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18590698 2008 Transmembrane domain of EphA1 receptor forms dimers in membrane-like environment.
18566674 2008 Expressions of EphA2 and EphrinA-1 in early squamous cell cervical carcinomas and their relation to prognosis.
18308734 2008 Fibronectin type I repeat is a nonactivating ligand for EphA1 and inhibits ATF3-dependent angiogenesis.
17980912 2008 EphA and ephrin-A proteins regulate integrin-mediated T lymphocyte interactions.
17634955 2007 Ephrin-A1 stimulates migration of CD8+CCR7+ T lymphocytes.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16862074 2006 Expression profile of Eph receptors and ephrin ligands in human skin and downregulation of EphA1 in nonmelanoma skin cancer.
16737551 2006 Over-expression of Eph and ephrin genes in advanced ovarian cancer: ephrin gene expression correlates with shortened survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12853948 2003 The DNA sequence of human chromosome 7.
12775584 2003 EphA4-mediated Rho activation via Vsm-RhoGEF expressed specifically in vascular smooth muscle cells.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11519828 2001 Characterization of the Epha1 receptor tyrosine kinase: expression in epithelial tissues.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10502115 1999 Signal transfer by eph receptors
10369740 1999 Genomic structure of the EPHA1 receptor tyrosine kinase gene.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
2825356 1987 A novel putative tyrosine kinase receptor encoded by the eph gene.