Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.45
PubTator Score 12.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.300 2.9e-02
ependymoma -1.500 3.5e-02
oligodendroglioma -1.100 7.8e-10
group 4 medulloblastoma -3.300 2.4e-11
cystic fibrosis -4.318 1.6e-08
atypical teratoid / rhabdoid tumor -1.800 8.9e-05
medulloblastoma, large-cell -2.500 1.4e-04
primitive neuroectodermal tumor -1.800 1.4e-04
primary pancreatic ductal adenocarcinoma 1.965 2.8e-04
non-small cell lung cancer -1.182 6.3e-07
breast carcinoma -1.200 4.3e-03
fibroadenoma -1.600 3.3e-02
invasive ductal carcinoma -1.800 1.4e-02
psoriasis -1.100 1.2e-06
Pick disease -1.600 3.1e-03
Breast cancer -1.600 9.8e-03
gastric carcinoma 1.300 2.8e-02
ductal carcinoma in situ -1.500 3.8e-03
ovarian cancer 1.300 2.2e-02
pituitary cancer 1.800 1.3e-06
pancreatic cancer 1.500 1.2e-03
head and neck cancer -2.000 2.0e-04

Synonym

Accession Q9UM22 A8K4C0 C9JYS3 Q06BL0 Q99M77 MERP-1
Symbols EPDR
UCC1
MERP1
MERP-1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (4)

PMID Text
24089297 Results of this study suggest that EPDR1 gene can be added to a growing list of genes associated with Dupuytren's disease development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18374504 Observational study of gene-disease association. (HuGE Navigator)
16954209 Shows that the mouse ortholog is a lysosomal protein.

AA Sequence

MPGRAPLRTVPGALGAWLLGGLWAWTLCGLCSLGAVGAPRPCQAPQQWEGRQVMYQQSSGRNSRALLSYD      1 - 70
GLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIG     71 - 140
GPQEQITVQEWSDRKSARSYETWIGIYTVKDCYPVQETFTINYSVILSTRFFDIQLGIKDPSVFTPPSTC    141 - 210
QMAQLEKMSEDCSW                                                            211 - 224
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24089297 2013 Common variants of the EPDR1 gene and the risk of Dupuytren’s disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21732829 2011 Wnt signaling and Dupuytren's disease.
20556588 2010 Effects of combined siRNA-TR and -TERT on telomerase activity and growth of bladder transitional cell cancer BIU-87 cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18374504 2008 Influence of multiple genetic polymorphisms on genitourinary morbidity after carbon ion radiotherapy for prostate cancer.
17302986 2007 Molecular evolution of the ependymin protein family: a necessary update.
16954209 2006 Demonstration of lysosomal localization for the mammalian ependymin-related protein using classical approaches combined with a novel density shift method.
16908269 Gene expression profiles characterize early graft response in living donor small bowel transplantation: a case report.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943480 2002 MERP1: a mammalian ependymin-related protein gene differentially expressed in hematopoietic cells.
11749721 2001 Identification and characterization of a novel family of mammalian ependymin-related proteins (MERPs) in hematopoietic, nonhematopoietic, and malignant tissues.
11248421 2001 The novel ependymin related gene UCC1 is highly expressed in colorectal tumor cells.