Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.24
PubTator Score 26.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3469 8.5e-23
ovarian cancer 8297 1.6e-06
osteosarcoma 7766 1.4e-04
group 3 medulloblastoma 4002 1.4e-03
Rheumatoid arthritis 1156 1.7e-03
hepatocellular carcinoma 536 3.1e-03
tuberculosis 1963 4.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Sexual disorder 3 0.0 1.4

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.700 8.5e-23
group 3 medulloblastoma 1.800 1.4e-03
hepatocellular carcinoma -1.200 3.1e-03
osteosarcoma -1.119 1.4e-04
ovarian cancer -1.200 1.6e-06
Rheumatoid arthritis 2.600 1.7e-03
tuberculosis 1.200 4.8e-03

Gene RIF (7)

AA Sequence

MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAISAQQVYGEKRD      1 - 70
NMVIPVPEAESNIAYYESIYPGEFKMPKQLIHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPLQFE     71 - 140
EMIDRLEKGSGQQPVSLQEAKLLLKEDDELIREVYEYWIKKRKNCRGPSLIPSVKQEKRDGSSTNDPYVA    141 - 210
FRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRREKSKRELLHLTLEIMEKRYNLGDYNG    211 - 280
EIMSEVMAQRQPMKPTYAIPIIPITNSSQFKHQEAMDVKEFKVNKQDKADLIRPKRKYEKKPKVLPSSAA    281 - 350
ATPQQTSPAALPVFNAKDLNQYDFPSSDEEPLSQVLSGSSEAEEDNDPDGPFAFRRKAGCQYYAPHLDQT    351 - 420
GNWPWTSPKDGGLGDVRYRYCLTTLTVPQRCIGFARRRVGRGGRVLLDRAHSDYDSVFHHLDLEMLSSPQ    421 - 490
HSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLYRSINRTGTAQ    491 - 560
PGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQNLASNQQKS    561 - 630
GFRLNIQGLERTLQGFVSKTLDSASAQFAASALVTSEQLMGFKMKDDVVLGIGVNGVLPASGVYKGLHLS    631 - 700
STTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVPSSVATVNSIA    701 - 770
PINARHIPRTLSAVPSSALKLAAAANCQVSKVPSSSSVDSVPRENHESEKPALNNIADNTVAMEVT        771 - 836
//

Text Mined References (36)

PMID Year Title