Property Summary

NCBI Gene PubMed Count 37
PubMed Score 6.17
PubTator Score 124.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -7.093 3.3e-06
mucosa-associated lymphoid tissue lympho... 2.387 2.1e-02
ductal carcinoma in situ -1.700 4.8e-03
invasive ductal carcinoma -1.700 2.6e-02
ovarian cancer -1.900 2.3e-17

Gene RIF (8)

PMID Text
21039340 study shows that cytoplasmic hereditary spherocytosis mutants cause impaired binding of protein 4.2 to AE1, leaving protein 4.2 susceptible to loss during erythrocyte development
20007969 Data suggest that one or both of proteins 4.1 and 4.2 cause a portion of band 3 to localize near the spectrin-actin junctions and provide another point of attachment between the membrane skeleton and the lipid bilayer.
19269200 Current understanding of protein 4.2, its known interactions & implications of protein 4.2 deficiency are reviewed. A new speculative "open" homology structure for the the active, membrane associated form is proposed. Review.
18051367 HIV-1 NC upregulates erythrocyte membrane protein band 4.2 (EPB42) in HEK 293T cells
16718373 The interactions of three protein 4.2-derived recombinant proteins with CDB3 and ankyrin were investigated by using Far-Western blot and pull-down assay.
14551146 protein 4.2 strongly influences CD47 levels as well as the extent of membrane skeleton attachment in erythrocytes
12393467 Evidence protein 4.2 interacts with the Rh membrane complex member CD47 obtained from red cells of patients with hereditary spherocytosis associated with complete protein 4.2 deficiency
12049649 spectrin binding domain

AA Sequence

MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPS      1 - 70
KINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNP     71 - 140
WNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVH    141 - 210
VARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLR    211 - 280
CLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILH    281 - 350
PSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNIST    351 - 420
KGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGD    421 - 490
AQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENT    491 - 560
FLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGL    561 - 630
IHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA             631 - 691
//

Text Mined References (41)

PMID Year Title
21039340 2011 Protein 4.2 interaction with hereditary spherocytosis mutants of the cytoplasmic domain of human anion exchanger 1.
20007969 2010 Protein 4.2 binds to the carboxyl-terminal EF-hands of erythroid alpha-spectrin in a calcium- and calmodulin-dependent manner.
19269200 Protein 4.2: a complex linker.
16718373 2006 Associations of protein 4.2 with band 3 and ankyrin.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14551146 2004 Protein 4.2 is critical to CD47-membrane skeleton attachment in human red cells.
12970870 2003 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene.
12646258 2003 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis.
12576321 2003 Cappuccino, a mouse model of Hermansky-Pudlak syndrome, encodes a novel protein that is part of the pallidin-muted complex (BLOC-1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434312 2002 Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1.
12393467 2003 Evidence that the red cell skeleton protein 4.2 interacts with the Rh membrane complex member CD47.
12176912 2002 Absence of CD47 in protein 4.2-deficient hereditary spherocytosis in man: an interaction between the Rh complex and the band 3 complex.
12049649 2002 Mapping of a spectrin-binding domain of human erythrocyte membrane protein 4.2.
11936273 2002 The pallidin (Pldn) gene and the role of SNARE proteins in melanosome biogenesis.
11390390 2001 Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z.
10610180 1999 The pallid gene encodes a novel, syntaxin 13-interacting protein involved in platelet storage pool deficiency.
10406914 1999 4.2 Nippon mutation in a non-Japanese patient with hereditary spherocytosis.
10333496 1999 Mapping of a palmitoylatable band 3-binding domain of human erythrocyte membrane protein 4.2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8608138 1996 Human erythrocyte dematin and protein 4.2 (pallidin) are ATP binding proteins.
8547605 1995 Band 4.2 Komatsu: 523 GAT-->TAT (175 Asp-->Tyr) in exon 4 of the band 4.2 gene associated with total deficiency of band 4.2, hemolytic anemia with ovalostomatocytosis and marked disruption of the cytoskeletal network.
8547071 1995 Band 4.2 Shiga: 317 CGC-->TGC in compound heterozygotes with 142 GCT-->ACT results in band 4.2 deficiency and microspherocytosis.
8499466 1993 Structural domain mapping and phosphorylation of human erythrocyte pallidin (band 4.2).
7925374 1994 Human erythrocyte membrane protein 4.2 is palmitoylated.
7819064 1994 A novel mutation in the erythrocyte protein 4.2 gene of Japanese patients with hereditary spherocytosis (protein 4.2 Fukuoka).
7803799 1995 A deletional frameshift mutation in protein 4.2 gene (allele 4.2 Lisboa) associated with hereditary hemolytic anemia.
7772513 1995 A point mutation in the protein 4.2 gene (allele 4.2 Tozeur) associated with hereditary haemolytic anaemia.
7626035 1995 Identification of a band-3 binding site near the N-terminus of erythrocyte membrane protein 4.2.
3276554 1988 Binding of ras p21 to bands 4.2 and 6 of human erythrocyte membranes.
2968981 1988 Associations of human erythrocyte band 4.2. Binding to ankyrin and to the cytoplasmic domain of band 3.
2300550 1990 Complete amino acid sequence and homologies of human erythrocyte membrane protein band 4.2.
2052563 1991 Organization of the gene for human erythrocyte membrane protein 4.2: structural similarities with the gene for the a subunit of factor XIII.
1826225 1991 Contribution of the band 3-ankyrin interaction to erythrocyte membrane mechanical stability.
1729896 1992 The gene for human erythrocyte protein 4.2 maps to chromosome 15q15.
1689063 1990 Molecular cloning of human protein 4.2: a major component of the erythrocyte membrane.
1558976 1992 An alanine-to-threonine substitution in protein 4.2 cDNA is associated with a Japanese form of hereditary hemolytic anemia (protein 4.2NIPPON).
1544941 1992 Human erythrocyte protein 4.2, a high copy number membrane protein, is N-myristylated.
1350227 1992 Human erythrocyte protein 4.2: isoform expression, differential splicing, and chromosomal assignment.
1284644 1992 The murine pallid mutation is a platelet storage pool disease associated with the protein 4.2 (pallidin) gene.