Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.07
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 3.300 2.1e-08
cutaneous lupus erythematosus -1.600 7.7e-03
psoriasis -3.800 1.7e-05
osteosarcoma -3.460 7.8e-10
posterior fossa group B ependymoma 1.700 9.1e-09
glioblastoma 1.100 2.0e-03
sonic hedgehog group medulloblastoma 2.200 1.9e-05
atypical teratoid / rhabdoid tumor 1.900 3.9e-03
medulloblastoma, large-cell 1.100 4.9e-04
primitive neuroectodermal tumor 1.800 9.0e-05
non-small cell lung cancer -1.322 1.1e-13
lung cancer -4.100 6.5e-06
active Crohn's disease 1.450 2.4e-03
active ulcerative colitis 1.429 6.4e-03
lung adenocarcinoma -1.100 7.8e-11
adult high grade glioma 1.100 3.3e-03
pilocytic astrocytoma 1.200 1.9e-04
subependymal giant cell astrocytoma 1.506 1.0e-02
lung carcinoma -1.500 2.6e-07
mucosa-associated lymphoid tissue lympho... 1.332 1.5e-02
ovarian cancer -1.400 2.3e-05

Synonym

Accession Q9HCS5 A4FUI6
Symbols NBL4
EPB41L4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYW      1 - 70
LDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGA     71 - 140
YAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDL    141 - 210
HPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTA    211 - 280
CKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSK    281 - 350
TYPKRIAQTQPAESNSISRITANMENGENEGTIKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ    351 - 420
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESEN    421 - 490
SNREYRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKEL    491 - 560
VDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTR    561 - 630
SSDAQGSGDATVHQRRNGSKDSLMEEKPQTSTNNLAGKHTAKTIKTIQASRLKTET                  631 - 686
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10874211 2000 Isolation and characterization of human NBL4, a gene involved in the beta-catenin/tcf signaling pathway.
10783258 2000 Molecular cloning of a novel NF2/ERM/4.1 superfamily gene, ehm2, that is expressed in high-metastatic K1735 murine melanoma cells.
8358434 1993 3,400 new expressed sequence tags identify diversity of transcripts in human brain.
7983158 1994 Structural diversity of band 4.1 superfamily members.