Property Summary

NCBI Gene PubMed Count 62
PubMed Score 116.18
PubTator Score 66.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (37)

Disease log2 FC p
nephrosclerosis -1.432 2.1e-02
urothelial carcinoma -3.100 5.6e-03
malignant mesothelioma 6.800 4.8e-09
astrocytic glioma -2.100 6.5e-03
ependymoma -2.200 2.0e-02
psoriasis 1.600 2.0e-03
glioblastoma multiforme -2.000 2.8e-12
oligodendroglioma -1.700 7.1e-11
osteosarcoma 1.918 4.9e-03
sonic hedgehog group medulloblastoma -1.600 5.7e-03
cystic fibrosis 1.170 1.2e-04
atypical teratoid / rhabdoid tumor -3.000 5.7e-07
primitive neuroectodermal tumor -1.700 3.0e-02
Duchenne muscular dystrophy 1.032 6.3e-09
Amyotrophic Lateral Sclerosis 1.005 9.3e-06
adrenocortical carcinoma -1.576 4.6e-03
tuberculosis and treatment for 3 months -3.100 9.2e-07
non-small cell lung cancer -1.196 5.4e-10
intraductal papillary-mucinous adenoma (... -2.700 5.2e-04
intraductal papillary-mucinous carcinoma... -2.400 5.9e-03
colon cancer -2.100 5.8e-03
lung cancer -2.000 3.5e-03
breast carcinoma -1.100 1.4e-03
diabetes mellitus -1.300 9.2e-03
adult high grade glioma -2.700 4.4e-05
primary Sjogren syndrome 1.600 1.9e-04
aldosterone-producing adenoma -1.104 4.8e-02
subependymal giant cell astrocytoma -1.755 1.8e-02
lung adenocarcinoma -1.100 5.0e-07
nasopharyngeal carcinoma 1.300 3.5e-03
Pick disease -1.600 8.5e-03
gastric carcinoma 1.400 2.5e-02
ulcerative colitis -1.600 2.4e-04
ovarian cancer -2.800 1.4e-09
Gaucher disease type 1 2.200 2.4e-02
pituitary cancer 1.100 1.8e-05
facioscapulohumeral dystrophy 2.000 9.6e-03

Gene RIF (38)

PMID Text
26300315 Downregulation of DAL-1/4.1B expression effectively suppresses DAL-1/4.1B protein expression in lung cancer cells.
25881295 Our study demonstrates for the first time that platelet-secreted miR-223 via P-MVs can promote lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 a central role of CADM1 in stabilizing the complex with 4.1B and MPP3
25631074 Cellular biotinylated erythrocyte membrane protein band 4.1-like 3 (EPB41L3) protein is incorporated into HIV-1 Gag virus-like particles
25621889 We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas
25609022 The results suggest that tumor suppressor DAL-1 could also attenuate epithelial-to mesenchymal transition and be important for tumor metastasis in the early transformation process in lung cancer.
25183197 Studies indicate that tumor suppressor protein 4.1B/DAL-1 plays a crucial regulatory role in cell growth and differentiation.
24828608 In granulosa cells, there are significant changes in expression during follicular maturation.
22782504 Loss of expression of the differentially expressed in adenocarcinoma of the lung protein is associated with metastasis of non-small cell lung carcinoma.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
21628394 miR-223, induced by the transcription factor Twist, posttranscriptionally downregulates EPB41L3 expression by directly targeting its 3'-untranslated regions.
21526423 aberrant CADM1 and 4.1B expression is involved in progression of breast cancer, especially in invasion into the stroma and metastasis
21131357 Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B).
21081044 The expressions of TSLC1 and 4.1B in non-small cell lung cancer tissues were significantly lower than that in adjacent lung tissues.
20651987 An inducible model of EPB41L3 expression in three-dimensional spheroids confirmed that reexpression of EPB41L3 induces extensive apoptotic cell death in ovarian cancers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19796685 Results identify erythrocyte protein band 4.1-like 3 (protein 4.1B) as an intracellular effector molecule of Synaptic Cell Adhesion Molecule 1 (SynCAM1) that is sufficient to recruit NMDA-type receptors (NMDARs) to SynCAM1 adhesion sites in COS7 cells.
19299464 Identify Golgi-specific protein 4.1 that appears to have an essential role in maintaining the structure of the Golgi and in assembly of a subset of membrane proteins.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19115211 Our results demonstrate a frequent, predominant epigenetic silencing of CADM1 and DAL-1 in nasal NK/T-cell lymphoma (NL), which likely play a synergic role in NL pathogenesis.
18554153 A growing body of evidence supports a role for loss of EPB41L3 in tumor progression, including in prostate cancer [review]
17640904 suggest a more general role for Protein 4.1B as a negative regulator of cancer progression to metastatic disease
17260099 TSLC1 and DAL-1 are involved in the pathogenesis of breast cancer and are frequently inactivated by methylation
16420693 These results suggest that protein methylation cooperates with DAL-1/4.1B-associated caspase 8-specific activation to induce apoptosis in breast cancer cells.
16213361 These studies implicate the DAL-1/4.1B locus in sporadic meningiomas less commonly than reported previously, and suggest that it is a progression rather than an initiation locus.
16205641 methylation of DAL-1 leading to loss of the expression, is an important event in the pathogenesis of non-small-cell lung cancer
16152585 promoter methylation of the 4.1B is one of the most frequent epigenetic alterations in RCCC and could predict the metastatic recurrence of the surgically resected RCCC
16142420 The low mutational frequency in the study discounts sequence variations in DAL-1/4.1B as the main mechanism underlying participation of this gene in the neoplastic transformation of meningiomas.
15837747 DAL-1 methylation is involved in the development and progression of non-small cell lung cancers and provides an indicator for poor prognosis.
15731777 4.1B gene deletion was statistically more common in ependymomas.
15688033 U2 domain, when properly targeted to the plasma membrane, contains all the residues necessary for mediating Protein 4.1B growth suppression.
15517334 protein 4.1B in mouse small intestine & DAL-1 in human colon showed similar distributions in normal intestinal epithelial cells; expression reduced in intestinal carcinoma; may function in preventing malignant transformation of intestinal epithelial cells
15334060 DAL-1/4.1B protein significantly inhibits PRMT3 methylation of cellular substrates, which may affect mechanism through which DAL-1/4.1B affects tumor cell growth.
15138999 Mechanisms such as genetic imprinting and monoallelic expression in combination with los os heterozygosity may be responsible for loss of EPB41L3 protein in early breast tumors.
12478663 DAL-1 has a role in the development of multiple meningioma and does not function as a tumor suppressor
12234973 TSLC1 and DAL-1, two distinct tumor suppressor proteins, directly associate in lung cancer.
12115567 DAL-1 protein functions at the interface between cell adhesion and apoptosis in suppressing breast cancer cell growth
11996670 Results show that three 14-3-3 isoforms, beta, gamma and eta, are DAL-1/Protein 4.1B-binding proteins.

AA Sequence

MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRREVTDKEQEFA      1 - 70
ARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVC     71 - 140
EHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLR    141 - 210
DDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPA    211 - 280
EAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIK    281 - 350
IRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS    351 - 420
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEE    421 - 490
VTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLPGYEPSRAEHLPGEPALDSDG    491 - 560
PGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSP    561 - 630
SLVPCFLFIFFFLLSASFSVPYALTLSFPLALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAAD    631 - 700
GETTATESDQEEDAELKAQELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQ    701 - 770
EDAPMIEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT    771 - 840
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVA    841 - 910
KAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHT    911 - 980
ETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHD    981 - 1050
QALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED                                    1051 - 1087
//

Text Mined References (70)

PMID Year Title
26300315 2015 DAL-1/4.1B contributes to epithelial-mesenchymal transition via regulation of transforming growth factor-? in lung cancer cell lines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25881295 2015 MicroRNA-223 delivered by platelet-derived microvesicles promotes lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 2015 Dynamic regulation of a cell adhesion protein complex including CADM1 by combinatorial analysis of FRAP with exponential curve-fitting.
25621889 2015 EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.
25609022 2015 DAL-1 attenuates epithelial-to mesenchymal transition in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25183197 2014 Tumor suppressor role of protein 4.1B/DAL-1.
24828608 2014 Differential expression of poliovirus receptor, regulator of G-protein signaling 11 and erythrocyte protein band 4.1-like 3 in human granulosa cells during follicular growth and maturation.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
22782504 2012 Loss of expression of the differentially expressed in adenocarcinoma of the lung (DAL-1) protein is associated with metastasis of non-small cell lung carcinoma cells.
21966409 2011 Protein 4.1B contributes to the organization of peripheral myelinated axons.
21796628 2012 A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients.
21628394 2011 miRNA-223 promotes gastric cancer invasion and metastasis by targeting tumor suppressor EPB41L3.
21526423 2012 Aberrant expression of tumor suppressors CADM1 and 4.1B in invasive lesions of primary breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21131357 2011 Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B).
21081044 2010 [Expressions and clinical significances of TSLC1 and 4.1B in non-small cell lung cancer].
20936779 2010 A human MAP kinase interactome.
20651987 2010 Microcell-mediated chromosome transfer identifies EPB41L3 as a functional suppressor of epithelial ovarian cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19796685 2009 SynCAM1 recruits NMDA receptors via protein 4.1B.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19299464 2009 A Golgi-associated protein 4.1B variant is required for assimilation of proteins in the membrane.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19115211 2009 Frequent concomitant epigenetic silencing of the stress-responsive tumor suppressor gene CADM1, and its interacting partner DAL-1 in nasal NK/T-cell lymphoma.
18554153 2008 Potential role of EPB41L3 (protein 4.1B/Dal-1) as a target for treatment of advanced prostate cancer.
17640904 2007 Protein 4.1B suppresses prostate cancer progression and metastasis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17260099 2007 Downregulation of TSLC1 and DAL-1 expression occurs frequently in breast cancer.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16420693 2006 The tumor suppressor DAL-1/4.1B and protein methylation cooperate in inducing apoptosis in MCF-7 breast cancer cells.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16242908 2005 Evolutionarily conserved coupling of transcription and alternative splicing in the EPB41 (protein 4.1R) and EPB41L3 (protein 4.1B) genes.
16213361 2005 Inactivation patterns of NF2 and DAL-1/4.1B (EPB41L3) in sporadic meningioma.
16205641 2006 Expression and methylation pattern of TSLC1 cascade genes in lung carcinomas.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16152585 2006 Promoter hypermethylation of the potential tumor suppressor DAL-1/4.1B gene in renal clear cell carcinoma.
16142420 2005 Mutational analysis of the DAL-1/4.1B tumour-suppressor gene locus in meningiomas.
15837747 2005 Promoter methylation of DAL-1/4.1B predicts poor prognosis in non-small cell lung cancer.
15737618 2005 The tumor suppressor DAL-1/4.1B modulates protein arginine N-methyltransferase 5 activity in a substrate-specific manner.
15731777 2005 Alterations of protein 4.1 family members in ependymomas: a study of 84 cases.
15688033 2005 Membrane localization of the U2 domain of Protein 4.1B is necessary and sufficient for meningioma growth suppression.
15517334 2004 Immunolocalization of protein 4.1B/DAL-1 during neoplastic transformation of mouse and human intestinal epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15334060 2004 DAL-1/4.1B tumor suppressor interacts with protein arginine N-methyltransferase 3 (PRMT3) and inhibits its ability to methylate substrates in vitro and in vivo.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15138999 2004 Allele-specific loss of heterozygosity at the DAL-1/4.1B (EPB41L3) tumor-suppressor gene locus in the absence of mutation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12542678 2003 Protein 4.1B associates with both Caspr/paranodin and Caspr2 at paranodes and juxtaparanodes of myelinated fibres.
12478663 2003 Multiple meningiomas: Investigating the molecular basis of sporadic and familial forms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12234973 2002 Direct association of TSLC1 and DAL-1, two distinct tumor suppressor proteins in lung cancer.
11996670 2002 The 4.1/ezrin/radixin/moesin domain of the DAL-1/Protein 4.1B tumour suppressor interacts with 14-3-3 proteins.
10888600 2000 Loss of DAL-1, a protein 4.1-related tumor suppressor, is an important early event in the pathogenesis of meningiomas.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9892180 1999 A novel member of the NF2/ERM/4.1 superfamily with growth suppressing properties in lung cancer.
9828140 1998 Four paralogous protein 4.1 genes map to distinct chromosomes in mouse and human.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.