Property Summary

NCBI Gene PubMed Count 38
PubMed Score 58.07
PubTator Score 16.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease -1.919 1.3e-02
active ulcerative colitis -1.501 2.7e-03
adult high grade glioma -3.000 6.1e-08
astrocytic glioma -1.200 2.4e-03
Astrocytoma, Pilocytic -2.000 3.2e-09
atypical teratoid / rhabdoid tumor -3.000 2.3e-10
breast carcinoma -1.100 1.0e-04
ductal carcinoma in situ -1.100 2.5e-03
ependymoma -3.300 7.3e-03
glioblastoma -1.200 3.6e-05
group 3 medulloblastoma -1.500 9.9e-03
interstitial cystitis -1.700 7.3e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.6e-03
invasive ductal carcinoma -1.100 2.0e-02
malignant mesothelioma -2.000 1.3e-07
medulloblastoma, large-cell -1.800 6.9e-04
nephrosclerosis -1.037 6.2e-04
oligodendroglioma -1.600 4.0e-02
osteosarcoma -2.047 4.4e-03
primitive neuroectodermal tumor -1.700 2.3e-02
psoriasis -3.400 1.0e-05

 GWAS Trait (2)

Gene RIF (8)

AA Sequence

MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSE      1 - 70
ADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGL     71 - 140
TFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFV    141 - 210
THALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKL    211 - 280
SMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTI    281 - 350
GFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS    351 - 420
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKELKPEQETTP    421 - 490
RHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGL    491 - 560
REGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHG    561 - 630
SAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETM    631 - 700
TVSSLAIRKKIEPEAVLQTRVSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMI    701 - 770
PGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ    771 - 840
ALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES                                 841 - 881
//

Text Mined References (44)

PMID Year Title