Property Summary

NCBI Gene PubMed Count 37
PubMed Score 55.10
PubTator Score 16.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis -1.037 6.2e-04
malignant mesothelioma -2.000 1.3e-07
astrocytic glioma -2.200 3.8e-03
ependymoma -3.400 3.7e-20
oligodendroglioma -1.900 8.8e-17
psoriasis -3.400 1.0e-05
glioblastoma -3.200 5.5e-06
osteosarcoma -2.047 4.4e-03
sonic hedgehog group medulloblastoma -2.900 5.9e-08
atypical teratoid / rhabdoid tumor -3.000 2.3e-10
medulloblastoma, large-cell -3.800 1.1e-07
primitive neuroectodermal tumor -1.700 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.800 4.6e-03
active Crohn's disease -1.919 1.3e-02
active ulcerative colitis -1.501 2.7e-03
breast carcinoma -1.100 1.0e-04
interstitial cystitis -1.900 1.2e-04
pediatric high grade glioma -3.100 1.2e-08
pilocytic astrocytoma -2.000 3.0e-09
ductal carcinoma in situ -1.100 2.5e-03
invasive ductal carcinoma -1.100 2.0e-02

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26648170 the data of the current study identified 4.1N as an inhibitor of hypoxiainduced tumor progression in epithelial ovarian cancer cells.
26575790 Data suggest that repression of JNK-c-Jun signaling through pancreatic polypeptide receptor 1 (PP1) is one of the key anti-tumor mechanisms of neuronal membrane cytoskeletal protein 4.1 (4.1N).
23400781 Kainate receptor GluK2a post-translational modifications differentially regulate association with 4.1N to control activity-dependent receptor endocytosis
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20468064 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
12181426 protein 4.1N/dopamine receptor interaction is required for localization or stability of dopamine receptors at the neuronal plasma membrane.

AA Sequence

MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSE      1 - 70
ADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGL     71 - 140
TFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFV    141 - 210
THALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKL    211 - 280
SMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTI    281 - 350
GFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS    351 - 420
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKELKPEQETTP    421 - 490
RHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGL    491 - 560
REGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHG    561 - 630
SAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETM    631 - 700
TVSSLAIRKKIEPEAVLQTRVSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMI    701 - 770
PGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ    771 - 840
ALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES                                 841 - 881
//

Text Mined References (43)

PMID Year Title
26648170 2016 4.1N suppresses hypoxia-induced epithelial-mesenchymal transition in epithelial ovarian cancer cells.
26575790 2016 Protein 4.1N acts as a potential tumor suppressor linking PP1 to JNK-c-Jun pathway regulation in NSCLC.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23994105 2013 Defective expression of Protein 4.1N is correlated to tumor progression, aggressive behaviors and chemotherapy resistance in epithelial ovarian cancer.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23400781 2013 Kainate receptor post-translational modifications differentially regulate association with 4.1N to control activity-dependent receptor endocytosis.
23256752 2013 The linoleic acid derivative DCP-LA increases membrane surface localization of the ?7 ACh receptor in a protein 4.1N-dependent manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21376300 2011 Excess of de novo deleterious mutations in genes associated with glutamatergic systems in nonsyndromic intellectual disability.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19503082 2009 Regulation of AMPA receptor extrasynaptic insertion by 4.1N, phosphorylation and palmitoylation.
19272819 Protein 4.1 and the control of ion channels.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18373558 2008 Band 4.1 proteins are expressed in the retina and interact with both isoforms of the metabotropic glutamate receptor type 8.
17219717 2006 Protein 4.1, a component of the erythrocyte membrane skeleton and its related homologue proteins forming the protein 4.1/FERM superfamily.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
15893517 2005 Nectin-like molecule 1 is a protein 4.1N associated protein and recruits protein 4.1N from cytoplasm to the plasma membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
12676536 2003 Association of the type 1 inositol (1,4,5)-trisphosphate receptor with 4.1N protein in neurons.
12574408 2003 Surface expression of GluR-D AMPA receptor is dependent on an interaction between its C-terminal domain and a 4.1 protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444087 2003 Protein 4.1N is required for translocation of inositol 1,4,5-trisphosphate receptor type 1 to the basolateral membrane domain in polarized Madin-Darby canine kidney cells.
12181426 2002 D2 and D3 dopamine receptor cell surface localization mediated by interaction with protein 4.1N.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11136977 2000 Pike. A nuclear gtpase that enhances PI3kinase activity and is regulated by protein 4.1N.
11050113 2000 Regulation of AMPA receptor GluR1 subunit surface expression by a 4. 1N-linked actin cytoskeletal association.
10594058 1999 Protein 4.1N binding to nuclear mitotic apparatus protein in PC12 cells mediates the antiproliferative actions of nerve growth factor.
10414974 1999 A novel neuron-enriched homolog of the erythrocyte membrane cytoskeletal protein 4.1.
9828140 1998 Four paralogous protein 4.1 genes map to distinct chromosomes in mouse and human.
9570967 1998 Radiation hybrid mapping of EPB41L1, a novel protein 4.1 homologue, to human chromosome 20q11.2-q12.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.