Property Summary

NCBI Gene PubMed Count 342
PubMed Score 166.06
PubTator Score 520.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -2.100 2.2e-08
oligodendroglioma 1.800 4.5e-03
osteosarcoma 1.682 1.1e-02
atypical teratoid / rhabdoid tumor -1.600 1.8e-04
medulloblastoma, large-cell -2.000 5.0e-05
primitive neuroectodermal tumor -1.100 2.6e-02
adrenocortical carcinoma -1.244 1.3e-03
tuberculosis -2.100 1.3e-05
non-small cell lung cancer -1.997 3.7e-25
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-02
lung cancer -4.500 6.0e-07
breast carcinoma -1.200 8.8e-04
lung adenocarcinoma -2.900 7.4e-18
sonic hedgehog group medulloblastoma -1.200 1.2e-02
nasopharyngeal carcinoma -1.600 1.5e-04
COPD -1.300 3.0e-03
lung carcinoma -1.800 1.4e-15
mucosa-associated lymphoid tissue lympho... 2.080 3.4e-02
ductal carcinoma in situ -1.400 4.7e-04
invasive ductal carcinoma -2.000 2.3e-03
ovarian cancer -2.300 6.4e-05

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
624352 screening 2626 / 0 / 361542 uHTS identification of HIF-2a Inhibitors in a luminesence assay
624357 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of HIF-2a
651580 screening 982 / 0 / 777 Single concentration confirmation of uHTS identification of HIF-2a Inhibitors in a luminesence assay
651581 confirmatory 25 / 0 / 184 Dose response confirmation of uHTS identification of HIF-2a Inhibitors in screening - selectivity counterscreen assays
652011 confirmatory 10 / 0 / 57 SAR Analysis small molecule inhibitors of HIF-1a in a panel assay

Gene RIF (322)

PMID Text
27025692 Demonstrate that mTORC1 inhibition leads to AKT activation and an increase in HIF2A expression, leading to chondrogenic differentiation of amniotic fluid stem cells.
27001172 HIF-dependent regulation of ITGA6 is one mechanism by which sorting for CD49f (+) cells enhances cancer stem cells.
26898802 Akey role for HIF-2alpha-induced Ptpmt1 upregulation in proliferation, survival and glucose metabolism of erythroleukemia cells.
26886654 overexpression predicts poor prognosis in gastric carcinoma [meta-analysis]
26883865 results are consistent with distant shared ancestry for African and Asian EPAS1 haplotypes and Denisovan adaptive introgression
26846782 High HIF-2alpha expression is associated with papillary thyroid carcinoma.
26842802 Findings indicated that HIF-2alpha promotes epithelial-mesenchymal transition in pancreatic cancer by regulating Twist2 binding to the promoter of E-cadherin.
26837714 Most human soft tissue sarcomas have lower levels of EPAS1 expression relative to normal tissue.
26782458 HIF-2alpha is highly expressed in lung cancer stem cells, which may lead to radioresistance. In conclusion, HIF-2alpha is a potential prognostic marker for lung cancer
26647960 HBV induces the HIF2alpha expression through its encoded protein HBx. This upregulates the HIF-2alpha expression by binding to the pVHL activating the NF-kappaB signaling pathway
26642852 although Hif-1alpha and Hif-2alpha synergize to suppress the development of acute myeloid leukemia, they are not required for leukemic stem cells maintenance.
26603154 Conditional inactivation of Vegfa, Hif1a, or Epas1 in recruited and resident myeloid cells that accumulated at sites of neovascularization did not significantly reduce choroidal neovascularization or oxygen-induced retinopathy.
26531845 First trimester extravillous cytotrophoblasts in placentas from pregnancy terminations exhibit nuclear localisation of both HIF-1a and HIF-2a.
26514359 Somatic gain-of-function HIF2A mutations are associated with sporadic central nervous system hemangioblastomas
26510548 We observed higher HIF1a and HIF2a expression in BA than in IHC.
26439684 Knockdown of HIF2alpha abrogated CXCR4 expression.
26432405 In neuroblastoma, transcription of HIF2A is strongly dependent on mTORC2.
26402839 increased nuclear expression indicates unfavorable prognosis in renal cell carcinoma patients [review]
26368009 The associations between HIF2A variants and different level of high altitude support that extremely high-altitude hypoxia challenge imposes selective effects on HIF2A variants among native Tibetans.
26342197 CCL5 signals from infiltrating bone marrow mesenchymal stem cells to HIF2alpha signals within prostate cancer (PCa) cells might play a key role to increase PCa stem cell population and PCa metastasis via altering the androgen receptor signals
26305551 Data indicate that both hypoxia inducible factor 1 alpha subunit (HIF-1alpha) and hypoxia-inducible factor 2 alpha (HIF-2alpha) play a role in the metastatic cascade in these two cell lines.
26296885 data suggest that targeting intestinal HIF-2alpha has a significant therapeutic potential in SCD pathophysiology
26263511 the genetic polymorphism of the EPAS1 gene may lead to variation of its gene expression levels to drive progression of the cancer and serve as a prognostic marker for NSCLC.
26148512 these data reveal a novel mechanism for the regulation of the expression of HIF2a, demonstrating that the HIF2a promoter is regulated by E2F1 directly and that Cezanne regulates HIF2a expression through control of E2F1 levels
26073780 A 3.4-kb Copy-Number Deletion near EPAS1 Is Significantly Enriched in High-Altitude Tibetans but Absent from the Denisovan Sequence.
25966094 Data show that knockdown of hypoxia-inducible factor-2alpha (HIF-2alpha) expression reduced HeLa cell colony formation and invasion capacity under both normoxic and hypoxic conditions.
25963717 A strong positive correlation between the mRNA expression levels of HIF-2alpha, CA9, VEGF, GLUT-1 and OPN suggests a specific hypoxia-associated profile of mRNA expression in glioblastoma multiforme
25936862 HIF3alpha has a transcriptional regulatory function, which negatively affects gene expression by competing with HIF1alpha and HIF2alpha in binding to transcriptional elements in target genes during hypoxia. (Review)
25912138 demonstrate that transcriptional regulation of HIF-2alpha seems to be restricted to neural cell-derived tumors, while HIF-1alpha is canonically regulated at the post-translational level uniformly across different tumor forms
25889867 activity of the mitochondrial anti-oxidant SOD2 and its pro-catabolic transcription factor HIF-2alpha, suggesting that an improved understanding of physiologic triggers of chondrocyte metabolic flexibility may provide new insight into the etiology of OA.
25831463 EPAS1 is a key factor in the EGFR-MET crosstalk.
25829424 HIF2alpha-Dependent Lipid Storage Promotes Endoplasmic Reticulum Homeostasis in Clear-Cell Renal Cell Carcinoma
25805230 Simultaneous HIF-1a and HIF-2a gene knockdown attenuates acquired radioresistance in Hela cells.
25792003 The frequencies of the G allele of EPAS1 SNP rs13419896 were significantly higher in the HAPC group than in the control group. Moreover, the A alleles of rs12619696 and rs4953354 were prevalent in the HAPC group, and their counterpart homozygotes were prevalent in the normal Tibetan group.
25730079 HIF-2alpha is involved in gastric carcinogenesis and disease progression and is a potential therapeutic target for gastric carcinoma
25726527 results from this study demonstrate that hypoxia induces LIF expression in human cancer cells mainly through HIF-2alpha
25719580 results indicated that the association between HIF-2alpha expression and prognostic values in HCC was inconspicuous, while the expression of HIF-2alpha was significantly associated with capsule infiltration, vein invasion, and histological grade
25715026 Demonstrate that iron deficiency augments megakaryocytic differentiation and proplatelet formation and suggest a potential role of HIF2alpha in megakaryopoiesis.
25627682 findings suggest that TACC3 could be recruited as a bridge to cooperatively mediate between the HIF-2alpha PAS-B.ARNT PAS-B complex, thereby participating more directly in HIF-dependent gene transcription than previously anticipated
25574837 activation of HIF2alpha/VE-PTP signaling via PHD2 inhibition has the potential to prevent the formation of leaky vessels and edema in inflammatory diseases such as ARDS
25569234 EPAS1 knockdown by siRNA in endothelial cells impacted genes that significantly overlapped with EPAS1 downstream genes in lung tissue including hypoxia responsive genes, and genes associated with emphysema severity.
25565665 Results show that up regulation of HIF2-a is observed in patients with chronic periodontal disease, and in an in vitro model of nicotine plus lipopolysccharide-stimulated periodontal ligament cells. Its inhibition exhibits anti-inflammatory activity.
25557012 GPX8 is transcriptionally regulated by HIFalpha and modulates growth factor signaling in HeLa cells.
25544768 Data indicate that hypoxia-induced cysteine-proteases inhibitor SERPINB3 up-regulation is dependent on hypoxia-inducible factor-2alpha (HIF-2alpha).
25520177 KDM6B is a new hypoxia response gene regulated by HIF-2alpha
25517638 Findings show that TET1 serves as a transcription co-activator that interacts with HIF-1alpha and HIF-2alpha to enhance their transactivation activity as well as INSIG1 in addition to its role in demethylating 5-methylcytosine.
25501874 High EPAS1 expression level in amnion is associated with higher birth weight of Tibetan newborns.
25489981 High HIF-2alpha expression is associated with angiogenesis in hepatocellular carcinoma.
25487445 our results demonstrated that hypoxia promoted the invasiveness and resistance of 786-O cells to sorafenib via HIF2 and COX-2 and induced the activation of Snail/E-cadherin.
25440060 Peroxisome abundance is reduced in von Hippel-Lindau (Vhl) tumor suppressor -deficient human clear cell renal cell carcinomas with high HIF-2alpha levels.
25436804 the EPAS1 rs4953354 may be a potentially susceptible marker for development of lung adenocarcinoma, especially in female never-smokers
25417700 results indicate a new role for HIF transcriptional pathways in the regulation of nuclear structure and that this contributes to the pro-tumorigenic hypoxia-phenotype in breast cancer
25396735 HIF-2alpha silencing in colon cancer cells altered the expression of the stem cell markers CD44, Oct4, and CD24 and of the differentiation marker CK20 in the opposite direction as HIF-1alpha silencing.
25391657 TRPM2-L function may be a novel approach to reduce tumor growth through modulation of HIF-1/2a, mitochondrial function, and mitophagy.
25338835 HIF-2alpha was involved in proliferation, metastasis and invasion of gastric cancer cells.
25271810 HIF-2alpha regulates NANOG expression in human embryonic stem cells following hypoxia and reoxygenation through the interaction with an Oct-Sox cis regulatory element.
25244496 evidence for a direct linkage between HIF-2alpha and increased expression of betaIII-t by hypoxia
25239027 The G-G-G haplotype of rs13419896, rs4953354,and rs1868092 was significantly more frequent in high altitude polycythemia patients than in control subjects
25218350 2-Methoxyestradiol synergizes with sorafenib to suppress hepatocellular carcinoma by simultaneously dysregulating expression hypoxia-inducible factor-1 and -2.
25216407 miR185 may be a tumor suppressor, affecting the development of colon cancer via inhibition of HIF2a signaling.
25192290 EPAS-1 specifically regulates SP-1-mediated FBI-1 expression and tumor cell proliferation.
25187556 HIF-1 and HIF-2 directly activate the expression of AXL and GAS6/AXL signaling uses lateral activation of the met proto-oncogene (MET) through SRC proto-oncogene nonreceptor tyrosine kinase to maximize cellular invasion.
25109928 Somatic HIF2alpha mutations clearly document the existence of an additional phenotype of this syndrome, that is, ocular abnormalities in addition to paraganglioma, somatostatinoma, and polycythemia.
25108527 The acetate-dependent acetyl CoA generator ACSS2 links changes in metabolism that occur during stress with the coupled processes of HIF-2 acetylation, which is mediated by the acetylase/coactivator CBP, and stable HIF-2/CBP complex formation, both of which are required for maximal HIF-2 signaling.
25085245 consecutive increase in HIF2alpha activity promotes the expression of various transporters and enzymes supporting the reductive and oxidative glutamine metabolism, whereas a reduction in functional HIF1alpha expression consolidates the inhibition of glycolysis
25046225 the undetectable PHD3 could contribute to the higher HIF-alpha expression in ccRCC.
24998849 This study indicates that autophagy has an anticancer role in clear-cell renal cell carcinoma tumorigenesis, and suggests that constitutive autophagic degradation of HIF2alpha is a novel tumor suppression mechanism.
24938788 Exposure of human breast cancer cells to hypoxia augments microvesicle (MVs) shedding that is mediated by the HIF-dependent expression of the small GTPase RAB22A, which colocalizes with budding MVs at the cell surface.
24884370 The AA genotype of EPAS1 gene in rs1867785, and the TT genotype in rs11689011, is even more underrepresented in elite sprint/ power athletes compared with their sub-elite counterparts.
24859386 Autophagy, inflammation, and/or upregulation of HIF2alpha could potentially contribute to the aggressive course of retinal hemangioblastoma, resulting in the resistance to multiple anti-VEGF and radiation therapies in these patients.
24850901 This study demonstrates a novel function of HIF (HIF1a and HIF2a)in regulating RNA splicing of HIF target genes
24825851 Upregulated EPAS1 expression in hypoxic colorectal cancer cells that were associated with DNA demethylation of the EPAS1 regulatory region.
24813631 The CATT data do not support a pharmacogenetic association between the 4 SNPs tested in EPAS1 and response to anti-VEGF therapy in patients with neovascular age-related macular degeneration.
24806027 Data suggest that hypoxia-induced expression of BOK (Bcl-2-related ovarian killer protein) in placental cells is regulated via promoter region, hypoxia-response element, and binding of hypoxia-inducible factors (HIF1A, HIF2A/EPAS1, HIF1B/ARNT).
24781045 HIF-2alpha signaling pathway appears to play one of the most important roles in pheochromocytoma/paraganglioma pathogenesis and other cancer development.
24741025 EPAS1 exons 9 and 12 mutations are associated with non-familial pheochromocytoma.
24726658 of 5% O2 rejuvenates WJ-MSC culture toward less-differentiated, more primitive and faster-growing phenotypes with involvement of HIF-1a and HIF-2a-mediated and TSA-sensitive chromatin modification mechanisms.
24705306 Hif-1alpha and Hif-2alpha competitively bind to NICD.
24704828 the c-Myc-mediated transcriptional repression of miR-15-16 in hypoxia is induced by increased HIF-2alpha and promoted tumor angiogenesis and hematogenous metastasis by the further loss of post-transcriptional inhibition of FGF2.
24661907 Sox9 is a downstream target of Hif2alpha in ovarian cancer cells.Hif-2alpha regulates TUBB3 gene expression and affects ovarian cancer aggressiveness.
24656769 HIF1alpha and HIF2alpha are required during early stages of reprogramming. HIF2alpha inhibits reprogramming when expressed during later stages of the process
24644426 PHD-1 played an important role in hypoxic response pathway of trophoblast through modulating the level of HIF-2alpha.
24607784 These results reveal a PHD2-mediated mechanism through which ET-1 stabilizes HIF-1alpha and HIF-2alpha pathway thereby regulating lymphatic endothelial cell behavior and lymphangiogenesis.
24513612 striking enrichment of high-altitude ancestry in the Tibetan genome, indicating that migrants from low altitude acquired adaptive alleles from the highlanders
24503013 HIF-1alpha and HIF-2alpha are involved in hypoxia-induced lipid accumulation in hepatocytes via reducing PGC-1alpha mediated fatty acid beta-oxidation.
24464808 HIF-2alpha upregulates transgelin indirectly and accumulated TGF-beta1 is a mediator in the upregulation of transgelin by HIF-2alpha under hypoxia.
24451260 PRMT1 is a novel regulator of HIF-1- and HIF-2-mediated responses.
24434023 Data indicate that hypoxia regulates prostatic acid phosphatase (PAP) through hypoxia-inducible factor 2 alpha (HIF2alpha) and from stimulated A2B adenosine receptors.
24423936 In the Gal4 reporter systems, Sirt1 was found to repress HIF-1alpha activity constantly in ten cancer cell-lines but to regulate HIF-2alpha activity cell type-dependently.
24394537 Ascorbate-induced up-regulation of cellular ferroportin levels was associated with increased levels of the iron regulatory protein IRP2, and the hypoxia-inducible factor HIF2alpha.
24394419 Tight control of hypoxia-inducible factor-alpha transient dynamics is essential for cell survival in hypoxia.
24371328 These findings highlight the importance of the hypoxia-sensing pathway and HIFs in clinical hematology.
24368849 there is an miR-218-RTK-HIF2alpha signaling axis that promotes GBM cell survival and tumor angiogenesis, particularly in necrotic mesenchymal tumors
24363272 all classes of RNA are profoundly regulated by hypoxia and implicated HIF as a major direct regulator of both the non-coding and coding transcriptome, acting predominantly through release of pre-bound promoter-paused RNApol2.
24356968 DDT expression mirrors MIF expression in ccRCC tumor sections with high correlation and that, mechanistically, DDT is a novel hypoxia-inducible gene and direct target of HIF1alpha and HIF2alpha.
24353279 Data show that forkhead transcription factor 4 (FoxO4) interacts with sterol regulatory element binding protein (SREBP)2 and hypoxia inducible factor (HIF)2alpha to modulate lanosterol 14alpha demethylase (CYP51) promoter activity.
24324596 HIF-1alpha overexpression was significantly associated with poor overall survival of colorectal cancer patients, particularly in Asian countries, while overexpression of HIF-2alpha was only associated with grade of tumor differentiation. (Meta-analysis)
24288553 Overexpression of HIF-2alpha, TWIST, and CXCR4 is associated with lymph node metastasis in papillary thyroid carcinoma.
24196071 HIF-2alpha has a role in persistence of neutrophilic inflammation in humans, mice and zebrafish
24176785 Acute hypoxia initially stabilizes both HIF1alpha and HIF2alpha subunits by inhibiting the HIF-prolylhydroxylase-mediated degradation of HIF proteins.
24070809 We estimated pharmacogenetic associations from a clinical trial of nAMD. No significant association or replication of previous associations were observed. Further investigation of the EPAS1 (HIF2A) gene, however, may, be merited.
24041620 Endothelial PAS domain protein 1(EPAS1) chr2:46441523(hg18) polymorphism C is strongly associated with susceptibility to high altitude pulmonary edema in Han Chinese; EPAS1 chr2:46441523(hg18) polymorphism G is present at high frequency in Tibetans.
24037341 Manipulating or reducing the HIF-2alpha response in keratinocytes could be a useful means to accelerate wound healing and tissue repair.
23958427 HIF-1 and HIF-2 specific gene activating functions respond differently to different stimuli.
23946285 Signaling interaction with TGF-beta promotes renal fibrogenesis in normoxia
23940778 The differentially regulated proteome characterized by this study can potentially guide translational research specifically aimed at effective clinical interventions for advanced VHL-mutant, HIF2alpha-over-expressing tumors.
23911400 Data indicate that transfection of HeLa cells with miR-17 and miR-20a led to an inhibition of Hif-1alpha and Hif-2alpha mRNA and protein expression and a lowered Hif DNA binding activity.
23900840 Hypoxia-inducible factor-2alpha-dependent hypoxic induction of Wnt10b expression in adipogenic cells.
23897427 Data indicate that transient knockdown of BRG1 or BRM reduces hypoxia induction of several known HIF1 and HIF2 target genes in Hep3B cells.
23886153 Elevations of HIF-2alpha expression are associated with non-small cell lung cancer.
23881929 Overexpression of HIF2A is associated with metastatic clear-cell renal cell carcinoma.
23873332 Co-transfection of HIF-1alpha siRNA and HIF-2alpha siRNA augmented downregulation of VEGF mRNA and protein in hypoxic retinal pigment epithelial cells.
23852087 HIF-2alpha expression was positively correlated with the induction of hypoxic genes in hepatoma cells.
23840432 HIF-1alpha and HIF-2alpha activate CD133 promoter through ETS proteins.
23750001 Knockdown of Sirt7 led to an increase in HIF-1alpha and HIF-2alpha protein levels and an increase in HIF-1 and HIF-2 transcriptional activity.
23716564 All of the identified polycythemic subjects with HIF2A mutations show serum erythropoietin in the normal range.
23588703 Correlation between HIF2A and HIF1A expression and gadobutrol dynamic contrast-enhanced magnetic resonance imaging parameters Ktrans and kep in prostate cancer.
23563312 HIF1alpha and HIF2alpha activate independent transcriptional programs through SRC that promote metastasis by coordinately regulating cell invasion and ECM remodeling
23533246 These results support a direct oncogenic role for HIF2A in human neoplasia and strengthen the link between hypoxic pathways and pheochromocytomas and paragangliomas.
23492195 Knockdown of HIF-2alpha and HIF-1alpha mRNA in pulmonary vascular endothelial cells decreased cell proliferation under normoxic as well as hypoxic conditions.
23479510 HIF2A and IGF2 expression correlates in human neuroblastoma cells and normal immature sympathetic neuroblasts.
23478175 IL-6 and IL-8 are HIF2alpha controlled cytokines for angiogenesis particularly in endothelial cells.
23473032 Expression of HIF-2a Is Sufficient to Induce Reductive Carboxylation and Lipogenesis from Glutamine in renal cell carcinoma cells.
23455322 HIF-2alpha mRNA expression, protein levels and HIF-2-dependent gene expression are regulated by PARP-1.
23447580 a constitutively active HIF2alpha is not sufficient to cause neoplastic transformation of proximal tubules, arguing against the idea that HIF2alpha activation is critical for ccRCC tumorigenesis
23418310 EPAS1 is involved in the sporadic presentation of the disease not only increases the percentage of PCCs/PGLs with known driver mutations, but also highlights the relevance of studying other hypoxia-related genes in apparently sporadic tumors.
23378636 These data support a critical role for CDCP1 as a unique HIF-2alpha target gene involved in the regulation of cancer metastasis.
23375698 Our results suggest that HIF-2alpha may represent a more aggressive phenotype in small cell lung cancer
23361906 2 additional unique HIF2A mutations, which disrupt the hydroxylation domain recognized by prolyl hydroxylase domain-2 containing protein, leading to stabilization of HIF-2alpha and increased expression of hypoxia-related genes.
23335846 A model in which the sustained synthesis of VEGF in lens epithelial cells, maintained under hypoxic condition, is regulated by a compensatory inter-relationship between HIF-1alpha and HIF-2alpha
23334958 Hypoxia provides two mechanisms of chondroprotection in human cartilage: inducing tissue production through HIF-2alpha and inhibiting tissue destruction mainly via HIF-1alpha.
23333640 Blocking of HIF-2alpha prevents the promoting effects of arsenite on the neoplastic transformation, migration, and chromosomal aberrations induced by BaP in HBE cells.
23303559 Atypical osteoclast HIF-driven metabolic pathway may be an adaptive mechanism to permit rapid bone resorption in the short term while ensuring curtailment of the process in the absence of re-oxygenation.
23275444 Data indicate that the new HIF2alpha partners microphthalmia-associated transcription factor, SOX10, and AP2alpha, which are master actors of melanoma development, were confirmed via co-immunoprecipitation experiments.
23227185 observations strongly suggest that EPAS1 is under selection for adaptation to the high-altitude life of Tibetan populations, including Sherpas
23222716 Data indicate that Overexpression or knockdown of miR-145 altered both the mRNA and protein levels of HIF-2alpha and its downstream genes, cyclin D1, matrix metalloproteinase 14 and vascular endothelial growth factor, in neuroblastoma cells.
23212661 Data gathered from cell lines, tumorigenicity studies, and primary hepatocellular carcinoma samples demonstrate a negative role of HIF-2alpha in tumors, which is mediated by the TFDP3/E2F1 pathway.
23194660 data in the present study suggest that the accumulations of HIF-1alpha and HIF-2alpha by JNK and ERK are involved in different levels of arsenite-induced biphasic effects
23174107 reduction of HIF-2alpha expression suppressed in vitro self-renewal ability and in vivo tumor initiation in aldehyde dehydrogenase-positive 4T1 cells
23103253 HIF-2alpha/mTORC1/SLC7A5 pathway mediates proliferation and tumor promoting properties of HIF-2alpha.
23090011 This is the first report of a germline gain-of-function EPAS1/HIF2A mutation associated with congenital polycythemia that is also associated with multiple PGL tumors.
23063455 Metabolic features of renal cancer are linked to VHL loss. VHL loss and the ensuing increase in the expression of hypoxia-inducible factor affect several metabolic pathways, including glycolysis and oxidative phosphorylation. [Review Article]
23042097 findings demonstrate that HIF-2alpha is a major regulator of COX2/mPGES-1/PGE(2) pathway in colon tumors
22966206 USF2 and hypoxia-inducible factor 2alpha (HIF2alpha) cooperatively activate HIF2 target genes during hypoxia.
22931260 Here we report two novel somatic gain-of-function mutations in the gene encoding hypoxia-inducible factor 2alpha (HIF2A) in two patients, one presenting with paraganglioma and the other with paraganglioma and somatostatinoma, both of whom had polycythemia.
22894905 HIF2alpha is a tumor promoter in cancer cells.
22869144 study demonstrates that mTORC2 complex stability and activation is redox sensitive, and further defined a novel role for p22(phox)-based Nox oxidases in eIF4E-dependent mRNA translation through mTORC2
22807441 The acetylase/deacetylase couple CREB-binding protein/Sirtuin 1 controls hypoxia-inducible factor 2 signaling.
22684009 basal expression of Ctr1 is regulated by HIF2alpha; however, the induction by hypoxia is a HIF2alpha-independent event
22673574 enhanced HIF-1alpha translation as molecular mechanism in HIF-2alpha knockdown (k/d) cells
22595196 Age was found to be significantly associated with the EPAS1 SNP in the chronic mountain sickness patients.
22537539 Data indicate that the invasion potencies were decreased more in ZnSO4-treated cells than in control cells after siRNA-mediated knockdown of hypoxia-inducible factors HIF-1alpha and/or HIF-2alpha.
22452996 HIF-2a was correlated with ABCG2 expression, histology-grade and Ki67 expression in breast invasive ductal carcinoma
22367913 HIF2A mutations, M535T, and F540L, were found in a heterozygous state in 4 patients with familial erythrocytosis. F540L impairs interaction of HIF-2alpha with both VHL and PHD2.
22277691 Exposure of varicose veins to hypoxic conditions was associated with increased expression of HIF-1alpha and HIF-2alpha protein and HIF target genes.
22247019 Our large-scale meta-analysis showed that the association of rs17039192 in HIF-2alpha with knee osteoarthritis is negative.
22113997 fine-mapping analysis of the 120 kb region flanking the EPAS1 gene on 2p21; study reports that chromosome 2p21 harbors a complex genetic architecture for common renal cell carcinoma risk variants
22103974 Elevated expression of HIF-2a can contribute to invasion and metastasis of adenoid cystic carcinoma (ACC), and there might be some correlation between the hypoxia microenvironment and epithelial-mesenchymal transition in ACC.
22095691 findings show that C/EBPbeta and RUNX2, with MMP-13 as the target and HIF-2alpha as the inducer, control cartilage degradation
22093255 Non-metal binding hypoxia mimetics, and hypoxia inhibit TNFalpha-mediated VCAM-1 expression via HIF1a/2a mechanism in endothelial cells.
22090111 HIF-1alpha and HIF-2alpha induce transcription of Kaposi's sarcoma-associated herpesvirus LANA.
22068265 Studies indicate that EPAS1, EGLN1 and PPARA genes subject to natural selection in native high-altitude Tibetans.
21985026 HIF-2alpha and VEGF expression are significantly up-regulated in microvasculature lysates from four restless legs patients' cortical brain tissue as compared with controls.
21984395 concluded that HIF2alpha plays an important role in the progression of uveal melanomas possibly by promoting the autocrine loop VEGF-pVEGFR2/KDR, and by enhancing the expression of LDHA gene
21983741 The EPAS1 gene might be under hypoxic selection induced by high altitude.
21946204 There is a negative corelation between the expression of HIF-2alpha and OCT-4 and the prognosis of non-small cell lung cancer.
21927022 HIF-2alpha-dependent auto-stimulatory tumor phenotype that, while promoting EGF signaling in cellular models, increased the survival of diagnosed and treated human patients
21925595 overexpression results in increased expression of IL-8 in endothelial cells
21888897 These results indicate that KLHL20 is a novel player that regulates HIF-2alpha protein expression through mechanisms independent of hypoxia and pVHL.
21869830 HIF-2alpha potentiates Fas-mediated chondrocyte apoptosis, which is associated with OA cartilage destruction.
21841824 in the first stages of clear cell renal cell carcinoma formation the stabilization of HIF-1alpha dominates, limiting proliferation, as the HIF-2alpha ratio increases, a more aggressive cell behavior emerges
21840298 A2aR, adenosine, and HIF-2alpha are key contributors to the potentiation of catecholamine secretion in developing chromaffin cells during chronic hypoxia.
21718164 Review of the role of mutation in EPAS-1 in human adaptation to high altitude hypobaric hypoxia.
21695080 reduced FH leads to the accumulation of hypoxia inducible factor- 2alpha (HIF-2alpha)
21637285 elevated expression of the hypoxia-inducible transcription factor-1 (HIF-1) and HIF-2 is a key feature of many human cancers and has been shown to promote cellular processes, which facilitate tumor progression
21610325 Results confirm that HIF-2alpha is tumor suppressive, and suggest that HIF-1alpha may also be tumor suppressive.
21571835 these results have provided new mechanistic insights into the differential regulation of HIF-1alpha and HIF-2alpha by the hypoxic tumor microenvironment.
21512126 mutations on ARNT PAS-B modulate coactivator selectivity and target gene induction by HIF in vivo, demonstrating a bifunctional role for transcriptional regulation by PAS domains within bHLH-PAS transcription factors
21483406 ZNF217 is overexpressed in GBMs and contributes to the maintenance of GSCs, which is regulated by HIFs released by the hypoxic environment of the tumor
21389259 The effect of HIF-2alpha gain-of-function mutations on cardiovascular function is reported.
21382346 This result revealed that CD82 negatively regulates the HUVECs cell migration. The induction of CD82 gene expression in endothelial cells provided new insights into a specific function of HIF-2.
21362301 Data conclude that HIF-1alpha and HIF-2alpha may differentially regulate the major angiogenic factors in different stages of the tumor process in NSCLC.
21327823 Elevated HIF-2alpha expression is associated with chondrosarcoma.
21263150 HIF2alpha is an important STAT5 target gene in human hematopoietic stem cells.
21257819 These findings identify snail as a HIF target gene.
21217668 Relevance of HIF-2alpha in human idiopathic osteoarthritis remains unclear, warranting further evaluation.
21127501 glioma stem cells exert paracrine effects on tumor growth through angiogenic factors at low pH augmented by up regulation of hypoxia inducible factor 2alpha expression
21109953 overexpression of Tbeta4 is strongly associated with HIF-1alpha and HIF-2alpha expression and is also clinicopathologically involved with lymph node metastatic potential of breast cancer
21081659 Underexpression of miR-148a and miR-20b in human embryonic stem cells (hESs) were differentiated toward Mesenchymal stem cell, compared with ESs, allows an increase in expression of the EPAS1.
21073737 Data reveal that HIF-1alpha and HIF-2alpha work together to modulate cancer metabolism and regulate genes signature overlapping with oncogenic KRAS.
21057546 TGF-beta1 activates VEGF expression via multiple routes including Smad3, HIF-2alpha and HuR signaling
21042786 Of specimens with VHL alterations 95.6% tested positive for EPO. EPO was identified in 96.2 and 94.2% of HIF-1alpha and HIF-2alpha positive specimens, respectively, compared to 72.4 and 53.8% for HIF-1alpha and HIF-2alpha negative groups (p<0.01).
21030426 Observational study of genotype prevalence. (HuGE Navigator)
20978319 HIF-1alpha, HIF-2alpha and CAIX were up-regulated in 88.2% (15/17), 100% (17/17) and 88.2% (15/17) of CCRCC tumors respectively and their expression is independent of VHL status.
20965423 Studies indicate that HIF2alpha is selectively expressed in the CD133+ subpopulation of glioblastoma cells, whereas HIF1alpha expression is widespread among both tumorigenic and nontumorigenic cells.
20964835 Analysis of renal carcinoma cells for expression of HIF-1a and HIF-2a confirmed high levels of hypoxia inducible factor in cells lacking functional von Hippel-Lindau (VHL) tumour suppressor.
20961960 Observational study and genome-wide association study of genotype prevalence. (HuGE Navigator)
20939709 prolyl hydroxylase domain protein (PHD) site-specifically hydroxylates the alpha-subunit of the transcription factor hypoxia-inducible factor alpha (HIF-alpha), thereby targeting the latter for degradation by the von Hippel-Lindau tumor-suppressor protein (VHL)
20856199 Data suggest that PHD2/HIF-2/amphiregulin signaling has a critical role in the regulation of breast tumor progression and propose PHD2 as a potential tumor suppressor in breast cancer.
20824203 a novel mechanism by which EMMPRIN promotes tumor progression through HIF-2alpha/VEGFR-2 mediated mechanism
20807755 The HIF-2alpha showed promoting roles in tumor angiogenesis and growth, and therapeutic outcome may benefit from combined targeting of HIF-2alpha
20632821 Immunostaining results identified HIF-1alpha expression in five (5/20) varicose vein specimens, whereas no control saphenous vein specimens expressed HIF-1alpha.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595611 SNP at EPAS1 shows a 78% frequency difference between Tibetan and Han samples, representing fastest allele frequency change observed to date; this SNP's association with erythrocyte abundance supports role of EPAS1 in adaptation to hypoxia
20559438 Both HIF-1alpha and HIF-2alpha are activated in close correlation with retinal hypoxia but have contrasting cell specificities, consistent with differential roles in retinal ischaemia
20559021 present work suggested that HIF-1alpha and HIF-2alpha were involved in metastasis and invasion of gastric cancer cells under hypoxia, with the involvement of JNK signal pathway
20551700 HIF2alpha is regulated by hypoxia in the developing human lung.
20534544 EPAS1 (HIF2alpha) is associated with low hemoglobin concentration in Tibetan highlanders
20534544 Observational study of gene-disease association. (HuGE Navigator)
20513003 The knockdown of HIF-2alpha raises autophagic activity and attenuates apoptosis by enhancing HIF-1alpha expression.
20496369 Both HIF-1 and HIF-2 serve as negative regulators of ANK expression in the disc. We
20416395 Hypoxia upregulated transcription from all three alternative HIF-3alpha promoters. siRNA experiments showed that this induction is mediated specifically by HIF-1 and not by HIF-2.
20395290 HIF-2alpha-mediated activation of the epidermal growth factor receptor potentiates head and neck cancer cell migration in response to hypoxia.
20375133 Hypoxia controls the expression of several tumor stem cell signature genes involved in the regulation of stemness as well as the stem cell properties of glioma cells, through HIF-2alpha.
20354189 iron regulatory protein-1-mediated inhibition of hypoxia-inducible factor-2a translation is linked to the anti-inflammatory 15-deoxy-delta12,14-prostaglandin J2
20304964 p22(phox)-based Nox oxidases maintain HIF-2alpha protein expression through inactivation of tuberin and downstream activation of ribosomal protein S6 kinase 1/4E-BP1 pathway
20224786 preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region
20204822 Uterine leiomyomas are severely and uniformly hypoxic, but do not induce HIF-1alpha, HIF-2alpha, glucose transporter (GLUT)-1 or carbonic anhydrase (CA) IX.
20158574 Mitochondria and HIFs are intimately connected to regulate each other resulting in appropriate responses to hypoxia.
20039838 Findings present the first evidence that HIF-2alpha is critically involved in the ROS-regulated vascular remodeling processes.
20032376 Detection of a loss-of-function HIF1A mutation in a primary RCC is consistent with HIF-1 and HIF-2 having different roles in renal tumourigenesis.
20028863 our findings recognize the PHD/HIF regulatory axis as a novel therapeutic target to disable a tumor's ability to adjust to hypoxic conditions and control cell survival
20015878 HIF2A is a newly identified regulator of C-X-C motif chemokine ligand (CXCL)12 expression in multiple myeloma plasma cells and a major contributor to multiple myeloma plasma cell-induced angiogenesis.
19955413 HIF-2alpha is a potentially universal culprit in promoting the persistent proliferation of neoplastic cells
19940151 Hsp70- and CHIP-dependent ubiquitination represents a molecular mechanism by which prolonged hypoxia selectively reduces the levels of HIF-1alpha but not HIF-2alpha protein.
19914104 HIF-1alpha expression was an independent predictor of cancer-specific survival in clear cell RCC with sarcomatoid differentiation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903792 HIF-1alpha and HIF-2alpha are differentially regulated in vivo in neuroblastoma
19837976 Data show that EMMPRIN up-regulate hypoxia-inducible factor-2alpha, VEGFR-2, and the soluble forms of VEGF in endothelial cells, thus directly regulating the angiogenic process.
19805377 HIF-2alpha as a marker of normoxic neural crest-like neuroblastoma tumor-initiating/stem cells (TICs) isolated from patient bone marrows.
19706526 Results correlate with altered p53 phosphorylation and target gene expression in untreated human tumor samples and show that HIF2alpha likely contributes to tumor cell survival including during radiation therapy.
19660915 Report expression of hypoxia-inducible factor-1alpha and hypoxia-inducible factor-2alpha with progression of keratinocytic neoplasms. (Letter)
19590888 The localization of hypoxia-inducible factor-1alpha and -2alpha supports concept that hypoxia is major stimulus for development of submacular wound healing and within this context choroid neovascularization is but one component of this process.
19541651 Analysis of the A(2A) receptor gene promoter revealed a hypoxia-responsive element in the region between -704 and -595 upstream of the transcription start site, and by using a ChIP assay, we demonstrate that HIF-2alpha binding to this region is specific.
19498162 findings show that Sirt1 promotes HIF-2 signaling during hypoxia and likely other environmental stresses
19483472 PTEN induces HIF-2alpha transcriptional activity by inhibiting expression of Yin Yang 1 (YY1), which acts as a novel corepressor of HIF-2alpha.
19481479 Only the HIF2A haplotype was shared by individuals who exhibit the high altitude pulmonary edema phenotype
19477429 GSCs differentially respond to hypoxia with distinct HIF induction patterns, and HIF2alpha might represent a promising target for antiglioblastoma therapies.
19460752 Knockdown of endothelial PAS domain protein 1 (EPAS1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19436307 HIF-1alpha, but not HIF-2alpha, might be used as a marker of prognosis, in addition to methods currently used, to enhance rectal cancer patient management.
19401348 Study concluded that in ccRCC, PAX2 reactivation is driven by HIF-dependent mechanisms following pVHL loss.
19386601 Within a tiled promoter array we identified 546 and 143 sequences that bound, respectively, to HIF-1alpha or HIF-2alpha at high stringency.
19322701 Increased HIF-2alpha expression is associated with renal cell carcinoma.
19287200 the results of the present study revealed that only HIF-1alpha, but not HIF-2alpha dimerizes with HIF-1beta and then regulates expression of target genes in response to hypoxia.
19252526 Type 2B R167Q mutant pVhl produces a unique profile of HIF dysregulation, thereby promoting tissue-specific effects on cell growth, development and tumor predisposition.
19238077 Pancreatic endocrine microadenomatosis in patients with von Hippel-Lindau disease: characterization by VHL/HIF pathway proteins expression.
19208626 find that all result in impaired degradation and thus aberrant stabilization of HIF-2alpha
19129502 crystal structures of the heterodimer formed by the C-terminal PAS domains from the HIF2alpha and ARNT subunits of the HIF2 transcription factor, both in the absence and presence of an artificial ligand
19080330 Data show that EPAS1 and VEGF, but not HIF1alpha, are overexpressed in pancreatic carcinoma.
19077391 Hypoxia-inducible factor-1alpha and -2alpha additively promote endothelial vasculogenic properties.
19030186 HIF-1alpha and HIF-2alpha have divergent roles in colon cancer
19021062 LDH5 is highly upregulated in B-cell non-Hodgkin lymphomas and is in direct relation to factor HIF1alpha and HIF2alpha expression. LDH5 expression is linked with activated VEGFR2/KDR expression
19010893 Hypoxia-inducible factor-2alpha correlates to distant recurrence and poor outcome in invasive breast cancer.
18957292 This study offers novel evidence supporting redox status regulation of HIF-2alpha accumulation under hypoxic conditions.
18945681 expression of hypoxia-inducible factors 1 alpha and 2 alpha is dependent on mTORC1 and mTORC2
18854154 Knockdown of endothelial PAS domain protein 1 (EPAS1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18787502 Observational study of gene-disease association. (HuGE Navigator)
18728663 Poorer survival of HIF-2 alpha and CA9 stromal-positive CRCs was associated with wild-type TP53, but not with BNIP3 methylation
18711622 HIF-2 alpha plays an important role in the regulation of Epo production.
18650473 Observational study of gene-disease association. (HuGE Navigator)
18625704 an angiogenic signal-ETS1/HIF-2alpha axis regulates the VEGFR1 chromatin domain to induce VEGFR1 transcription in endothelial cells and in differentiating embryonic stem cells
18508787 the HIF2A(M535I) gene mutation could induce hereditary erythrocytosis at a young age
18443354 HIV-1 Nef increases expression of both VEGF and its transcriptional regulator, hypoxia-inducible factor 2alpha (HIF-2alpha), in a Src kinase-and Stat3-dependent manner
18442887 the region between -3 kb and -1 kb is required for the minimal skeletal tissue-specific expression of Runx2, and that the region between -155 bp and -75 bp is important for its basal transcription, which may be in part mediated by HIF2A in bone tissues.
18423372 HIF-2alpha differentially binds and regulates transcription under hypoxia.
18420194 Data show that the specific contribution of hypoxia-inducible factor-2alpha to hypoxic gene expression in vitro is limited and modulated by cell type-specific and exogenous factors.
18378852 Observational study of gene-disease association. (HuGE Navigator)
18319549 The ratio of the HIF-2alpha positive cell in tumor infiltrative macrophages may be a new predictive indicator for prognosis before radiation therapy for uterine cervical cancer.
18077449 new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha
18055454 HIF-1 and HIF-2 have roles in SK1 upregulation during hypoxia in glioma cells
18024825 HIF-1 and HIF-2 are detected in the endothelium and macrophages. Hypoxia-inducible factors in endothelial cells may induce VEGF, thereby contributing to the development of choroid neovascularization.
17907154 we provide the first evidence that HIF-2alpha is essential for hypoxic induction of the human articular chondrocyte phenotype via SOX9
17852557 high levels of the hypoxia regulated proteins HIF1alpha and CA9 in HNC predict resistance to platinum based radio-chemotherapy.
17718430 Under hypoxic conditions, HIF-1alpha and HIF-2alpha proteins are not transcriptionally regulated at the mRNA level but are probably regulated at the post-mRNA level.
17570486 both HIF-1alpha and HIF-2alpha play important and similar roles in hypoxia-mediated stimulation of PAI-1 expression in HTR-8/SVneo cells
17562539 hypoxia-inducible factor-1alpha (HIF-1alpha) and HIF-2alpha in prostate cancer has been confirmed
17555795 cytoplasmic expression of HIF-2alpha in ovarian carcinomas was higher than that in benign and borderline tumors; cytoplasmic expression of HIF-2alpha was significantly higher in stage III and IV tumors than stages I and II
17526729 Quantitative differences with respect to HIF deregulation are sufficient to account for the differential risks of kidney cancer linked to VHL mutations.
17495954 HIF-2alpha was strongly expressed in both the epidermis and in capillary endothelial cells of the dermis in psoriasis.
17477366 There may be a hormonal and hypoxia-independent regulatory mechanism coordinating the expression of HIF-1alpha, HIV-2alpha, VEGF, the androgen receptor, and FOXP1 in prostate tumors.
17452775 The role of protein expression of hypoxia-inducible factor (HIF)-1alpha, HIF-2alpha, carbonic anhydrase 9 (CA9) and glucose transporter 1 (GLUT1) in patients with colorectal adenocarcinomas.
17437013 The late expression of HIF-2alpha in the Barrett's carcinogenesis sequence and its high expression in adenocarcinoma suggest it as a morker of disease progression.
17417656 discovery of a conserved, functional iron-responsive element (IRE) in the 5' untranslated region of the messenger RNA encoding EPAS1
17285230 Overexpression of the HIF-2A is associated with astrocytomas
17220275 HIF2alpha C-terminal transactivation domain, in contrast to the HIF1alpha C-terminal transactivation domain, is relatively resistant to the inhibitory effects of FIH1 under normoxic conditions
17140440 MT1-MMP is a major mediator of tumor cell invasiveness and type I collagen degradation by VHL RCC cells that express either MT1-MMP or HIF-2alpha
17097563 Results describe the differential recruitment of HIF-1alpha and HIF-2alpha to common target genes in neuroblastoma, and show that HIF-2alpha promotes an aggressive phenotype.
16920734 knockdown of the HIF-2alpha gene demonstrated that HIF-2alpha regulates VEGF production, expression of which is essential in renal cell carcinoma
16885164 HIF-P4H, HIF-1alpha and HIF-2alpha are effective oxygen sensors
16826581 High HIF-2alpha expression is associated with head and neck cancer
16760477 hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha stabilization and transactivation in a graded oxygen environment are regulated in a cell-specific manner
16554418 In the normal, fully developed kidney, HIF-1alpha is expressed in most cell types, whereas HIF-2alpha is mainly found in renal interstitial fibroblast-like cells and endothelial cells
16284786 HIF-1alpha and HIF-2alpha mRNA levels are transiently increased in untrained human skeletal muscle in response to an acute exercise bout, but this response is blunted after exercise training.
16278385 androgen receptor is involved in VEGF and hypoxia sensing via hypoxia-inducible factors HIF-1a, HIF-2a, and the prolyl hydroxylases in human prostate cancer
16263938 The role of HIF-1alpha and HIF-2alpha on cell migration and proliferation in fibroblasts during hypoxia is reported.
16208515 Observational study of gene-disease association. (HuGE Navigator)
16208515 DNA variants in EPAS1 influence the relative contribution of aerobic and anaerobic metabolism and hence the maximum sustainable metabolic power for a given event duration
16098466 Overexpression of HIF-2alpha in glioma tumors enhances angiogenesis but reduces growth of these tumors, in part by increasing tumor cell apoptosis.
15964822 Enhanced expression of HIF2A suppressed HIF1A and vice-versa.
15653678 Results describe the specific interaction of hypoxia-inducible factors (HIF)-2alpha, but not HIF-1alpha, with the NF-kappaB essential modulator (NEMO).
15652356 HIF-2alpha protein is selectively present in human fetal week 8.5 SNS paraganglia. HIF-2alpha was detected in hypoxic and in well-oxygenized neuroblastoma cells and tissue, presumably reflecting their embryonic features.
15598469 The HIF2A is a transcription factor that plays a key role in the response of cells to oxygen levels.
15247232 HIF1a and HIF2a are regulated by PHD1, PHD2, and PHD3
15240563 the complete EPO enhancer displayed dependency on HIF-2alpha regulation, indicating that additional cis-acting elements confer HIF-2alpha specificity within this region
15217953 HIF-1alpha and HIF-2alpha in renal cell carcinoma harboring VHL mutations do not have a major role in radiosensitivity
15192019 EPAS1 may contribute to the construction of mature vessels by modulating the coordinated expressions of VEGF, Flt-1, Flk-1, and Tie2.
15156561 siRNA targeted degradation of HIF-1alpha and HIF-2alpha results in decreased hypoxia-induced PHD3 expression
15039136 role of EPAS1 and Sp1 in the hypoxic response of cancer cells
14985465 deregulation of hypoxia-inducible genes in VHL-/- cells can be attributed mainly to deregulation of HIF and validate HIF as a therapeutic anticancer drug target
14966910 HIF-2alpha/EPAS1 is expressed in most of hepatocellular carcinoma with capsular infiltration and portal vein invasion, which indicates a possible role of HIF-2alpha/EPAS1 in HCC
14744852 trans-regulation between HIF-1alpha and HIF-2alpha during hypoxia likely conveys target gene specificity
14691554 HIF2alpha has a role in regulating pVHL-defective tumor growth
14668441 HIF-2alpha PAS-B binds the analogous ARNT domain in vitro
14645546 hypoxic gene induction in cells expressing HIF-2alpha but not HIF-1alpha
14512791 Hypoxia-inducible factors 1alpha and 2alpha have roles in vascular endothelial growth factor expression and in nodular malignant melanomas of the skin
12823854 HIF2A is upregulated in rheumatoid arthritis and osteoarthritis.
12697324 HIF-2alpha regulates glyceraldehyde-3-phosphate dehydrogenase gene expression in vascular endothelial cells.
12588875 MAPK signaling facilitates HIF1a and HIF2a activation through p300/CBP
12464608 HIF-2alpha and Ets-1 binding is required for transcriptional activation of Flk-1 in endothelial cells
12209691 expression related to increased angiogenesis in endometrial adenocarcinoma
12123724 enzymatic hydroxylation of a conserved prolyl residue in hypoxia-inducible factor alpha subunits governs capture by the pVHL E3 ubiquitin ligase complex
11823643 hypoxic induction of the COOH-terminal transactivation domain (CAD)occurs through abrogation of hydroxylation of a conserved asparagine in the CAD

AA Sequence

MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLL      1 - 70
SSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDH     71 - 140
EEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNS    141 - 210
LCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEF    211 - 280
YHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN    281 - 350
DVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN    351 - 420
FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYT    421 - 490
SLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTP    491 - 560
QHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSS    561 - 630
MGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMV    631 - 700
ALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPM    701 - 770
RGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT    771 - 840
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT                                            841 - 870
//

Text Mined References (343)

PMID Year Title
27025692 2016 Rapamycin-Induced Hypoxia Inducible Factor 2A Is Essential for Chondrogenic Differentiation of Amniotic Fluid Stem Cells.
27001172 2016 ITGA6 is directly regulated by hypoxia-inducible factors and enriches for cancer stem cell activity and invasion in metastatic breast cancer models.
26898802 2016 Ptpmt1 induced by HIF-2? regulates the proliferation and glucose metabolism in erythroleukemia cells.
26886654 2016 Clinicopathological Differences and Prognostic Value of Hypoxia-Inducible Factor-2? Expression for Gastric Cancer: Evidence From Meta-Analysis.
26883865 2016 Wide distribution and altitude correlation of an archaic high-altitude-adaptive EPAS1 haplotype in the Himalayas.
26846782 2016 Expression of HIF-1? and HIF-2? correlates to biological and clinical significance in papillary thyroid carcinoma.
26842802 2016 HIF-2? promotes epithelial-mesenchymal transition through regulating Twist2 binding to the promoter of E-cadherin in pancreatic cancer.
26837714 2016 Epigenetic re-expression of HIF-2? suppresses soft tissue sarcoma growth.
26782458 2015 High expression of HIF-2? and its anti-radiotherapy effect in lung cancer stem cells.
26647960 2016 Hepatitis B virus induces hypoxia-inducible factor-2? expression through hepatitis B virus X protein.
26642852 2015 Hif-1? and Hif-2? synergize to suppress AML development but are dispensable for disease maintenance.
26603154 2016 Myeloid-Derived Vascular Endothelial Growth Factor and Hypoxia-Inducible Factor Are Dispensable for Ocular Neovascularization--Brief Report.
26531845 2015 Hypoxia induced HIF-1/HIF-2 activity alters trophoblast transcriptional regulation and promotes invasion.
26514359 2016 Somatic gain-of-function HIF2A mutations in sporadic central nervous system hemangioblastomas.
26510548 2015 Hypoxic-ischemic gene expression profile in the isolated variant of biliary atresia.
26439684 2015 HIF2? is involved in the expansion of CXCR4-positive cancer stem-like cells in renal cell carcinoma.
26432405 2015 PI3K-mTORC2 but not PI3K-mTORC1 regulates transcription of HIF2A/EPAS1 and vascularization in neuroblastoma.
26402839 2015 Prognostic Significance of Hypoxia-Inducible Factor Expression in Renal Cell Carcinoma: A PRISMA-compliant Systematic Review and Meta-Analysis.
26368009 2015 HIF2A Variants Were Associated with Different Levels of High-Altitude Hypoxia among Native Tibetans.
26342197 2015 Infiltrating bone marrow mesenchymal stem cells (BM-MSCs) increase prostate cancer cell invasion via altering the CCL5/HIF2?/androgen receptor signals.
26305551 2015 HIF isoforms have divergent effects on invasion, metastasis, metabolism and formation of lipid droplets.
26296885 2015 Intestine-specific Disruption of Hypoxia-inducible Factor (HIF)-2? Improves Anemia in Sickle Cell Disease.
26263511 2015 The A Allele at rs13419896 of EPAS1 Is Associated with Enhanced Expression and Poor Prognosis for Non-Small Cell Lung Cancer.
26148512 2015 Cezanne regulates E2F1-dependent HIF2? expression.
26073780 2015 A 3.4-kb Copy-Number Deletion near EPAS1 Is Significantly Enriched in High-Altitude Tibetans but Absent from the Denisovan Sequence.
25966094 2015 Hypoxia-inducible factor-2? (HIF-2?) mediates the effects of hypoxia on the promotion of HeLa cell viability, colony formation, and invasion capacity in vitro.
25963717 2015 mRNA expression levels of hypoxia-induced and stem cell-associated genes in human glioblastoma.
25936862 2015 Progress on hypoxia-inducible factor-3: Its structure, gene regulation and biological function (Review).
25912138 2015 Differential regulation of HIF-1? and HIF-2? in neuroblastoma: Estrogen-related receptor alpha (ERR?) regulates HIF2A transcription and correlates to poor outcome.
25889867 2015 Mitochondrial respiration and redox coupling in articular chondrocytes.
25831463 2015 Endothelial PAS domain-containing protein 1 confers TKI-resistance by mediating EGFR and MET pathways in non-small cell lung cancer cells.
25829424 2015 HIF2?-Dependent Lipid Storage Promotes Endoplasmic Reticulum Homeostasis in Clear-Cell Renal Cell Carcinoma.
25805230 2015 The acquired radioresistance in HeLa cells under conditions mimicking hypoxia was attenuated by a decreased expression of HIF subunit genes induced by RNA interference.
25792003 2015 EPAS1 Gene Polymorphisms Are Associated With High Altitude Polycythemia in Tibetans at the Qinghai-Tibetan Plateau.
25730079 2015 Relationship between clinicopathological features and HIF-2? in gastric adenocarcinoma.
25726527 2015 HIF-2? mediates hypoxia-induced LIF expression in human colorectal cancer cells.
25719580 2015 Prognostic significance and clinicopathological features of hypoxic inducible factor-2alpha expression in hepatocellular carcinoma.
25715026 2015 Increased expression of HIF2? during iron deficiency-associated megakaryocytic differentiation.
25627682 2015 Coiled-coil coactivators play a structural role mediating interactions in hypoxia-inducible factor heterodimerization.
25574837 2015 HIF2? signaling inhibits adherens junctional disruption in acute lung injury.
25569234 2015 Integrative analysis of DNA methylation and gene expression data identifies EPAS1 as a key regulator of COPD.
25565665 2015 HIF-2 Inhibition Supresses Inflammatory Responses and Osteoclastic Differentiation in Human Periodontal Ligament Cells.
25557012 2015 Glutathione peroxidase 8 is transcriptionally regulated by HIF? and modulates growth factor signaling in HeLa cells.
25544768 2015 Hypoxia up-regulates SERPINB3 through HIF-2? in human liver cancer cells.
25520177 2015 Regulation of histone demethylase KDM6B by hypoxia-inducible factor-2?.
25517638 2014 TET1 regulates hypoxia-induced epithelial-mesenchymal transition by acting as a co-activator.
25501874 2014 Two functional loci in the promoter of EPAS1 gene involved in high-altitude adaptation of Tibetans.
25489981 2015 HIF-2alpha-dependent PAI-1 induction contributes to angiogenesis in hepatocellular carcinoma.
25487445 2015 Hypoxia promotes 786-O cells invasiveness and resistance to sorafenib via HIF-2?/COX-2.
25440060 2014 Hif-2? promotes degradation of mammalian peroxisomes by selective autophagy.
25436804 2014 Association of EPAS1 gene rs4953354 polymorphism with susceptibility to lung adenocarcinoma in female Japanese non-smokers.
25417700 2015 Tumor hypoxia induces nuclear paraspeckle formation through HIF-2? dependent transcriptional activation of NEAT1 leading to cancer cell survival.
25396735 2014 Hypoxia-inducible factors modulate the stemness and malignancy of colon cancer cells by playing opposite roles in canonical Wnt signaling.
25391657 2014 A splice variant of the human ion channel TRPM2 modulates neuroblastoma tumor growth through hypoxia-inducible factor (HIF)-1/2?.
25338835 2015 HIF2? is associated with poor prognosis and affects the expression levels of survivin and cyclin D1 in gastric carcinoma.
25271810 2014 HIF-2? regulates NANOG expression in human embryonic stem cells following hypoxia and reoxygenation through the interaction with an Oct-Sox cis regulatory element.
25244496 2014 Hypoxia-inducible factor-2? (HIF-2?), but not HIF-1?, is essential for hypoxic induction of class III ?-tubulin expression in human glioblastoma cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25239027 2014 An EPAS1 haplotype is associated with high altitude polycythemia in male Han Chinese at the Qinghai-Tibetan plateau.
25218350 2014 2-Methoxyestradiol synergizes with sorafenib to suppress hepatocellular carcinoma by simultaneously dysregulating hypoxia-inducible factor-1 and -2.
25216407 2014 MicroRNA-185 suppresses growth and invasion of colon cancer cells through inhibition of the hypoxia?inducible factor-2? pathway in vitro and in vivo.
25192290 2014 EPAS-1 mediates SP-1-dependent FBI-1 expression and regulates tumor cell survival and proliferation.
25187556 2014 Direct regulation of GAS6/AXL signaling by HIF promotes renal metastasis through SRC and MET.
25109928 2014 Ocular manifestations of hypoxia-inducible factor-2? paraganglioma-somatostatinoma-polycythemia syndrome.
25108527 2014 An acetate switch regulates stress erythropoiesis.
25085245 2014 The SIRT1/HIF2? axis drives reductive glutamine metabolism under chronic acidosis and alters tumor response to therapy.
25046225 2014 Constitutive expression of HIF-? plays a major role in generation of clear-cell phenotype in human primary and metastatic renal carcinoma.
24998849 2015 Autophagy mediates HIF2? degradation and suppresses renal tumorigenesis.
24938788 2014 Hypoxia-inducible factors and RAB22A mediate formation of microvesicles that stimulate breast cancer invasion and metastasis.
24884370 2014 EPAS1 gene variants are associated with sprint/power athletic performance in two cohorts of European athletes.
24859386 2014 Upregulation of hypoxia-inducible factors and autophagy in von Hippel-Lindau-associated retinal hemangioblastoma.
24850901 2014 Hypoxia regulates alternative splicing of HIF and non-HIF target genes.
24825851 2014 Prognostic potential of DNA methylation and transcript levels of HIF1A and EPAS1 in colorectal cancer.
24813631 2014 Endothelial PAS domain-containing protein 1 (EPAS1) gene polymorphisms and response to anti-VEGF therapy in the comparison of AMD treatments trials (CATT).
24806027 2014 Hypoxia-inducible regulation of placental BOK expression.
24781045 2014 A new twist in neuroendocrine tumor research: Pacak-Zhuang syndrome, HIF-2? as the major player in its pathogenesis and future therapeutic options.
24741025 2014 Frequent EPAS1/HIF2? exons 9 and 12 mutations in non-familial pheochromocytoma.
24726658 2014 Low oxygen atmosphere facilitates proliferation and maintains undifferentiated state of umbilical cord mesenchymal stem cells in an hypoxia inducible factor-dependent manner.
24705306 2014 Hif-1? and Hif-2? differentially regulate Notch signaling through competitive interaction with the intracellular domain of Notch receptors in glioma stem cells.
24704828 2015 c-Myc-mediated repression of miR-15-16 in hypoxia is induced by increased HIF-2? and promotes tumor angiogenesis and metastasis by upregulating FGF2.
24661907 2014 Sox9 and Hif-2? regulate TUBB3 gene expression and affect ovarian cancer aggressiveness.
24656769 2014 Hypoxia-inducible factors have distinct and stage-specific roles during reprogramming of human cells to pluripotency.
24644426 2014 Study on the expressions of PHD and HIF in placentas from normal pregnant women and patients with preeclampsia.
24607784 2014 Endothelin-1 regulates hypoxia-inducible factor-1? and -2? stability through prolyl hydroxylase domain 2 inhibition in human lymphatic endothelial cells.
24513612 2014 Admixture facilitates genetic adaptations to high altitude in Tibet.
24503013 2014 HIF-1? and HIF-2? are critically involved in hypoxia-induced lipid accumulation in hepatocytes through reducing PGC-1?-mediated fatty acid ?-oxidation.
24464808 2014 Transgelin as a therapeutic target to prevent hypoxic pulmonary hypertension.
24451260 2014 Transcriptional repression of hypoxia-inducible factor-1 (HIF-1) by the protein arginine methyltransferase PRMT1.
24434023 2014 The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.
24423936 2014 Differential roles of Sirt1 in HIF-1? and HIF-2? mediated hypoxic responses.
24394537 2014 Iron transport through ferroportin is induced by intracellular ascorbate and involves IRP2 and HIF2?.
24394419 2014 Tight control of hypoxia-inducible factor-? transient dynamics is essential for cell survival in hypoxia.
24378640 2014 HIF1? deubiquitination by USP8 is essential for ciliogenesis in normoxia.
24371328 2014 Targeting the hypoxia-sensing pathway in clinical hematology.
24368849 2014 miR-218 opposes a critical RTK-HIF pathway in mesenchymal glioblastoma.
24363272 2014 Extensive regulation of the non-coding transcriptome by hypoxia: role of HIF in releasing paused RNApol2.
24356968 2014 Dysregulated D-dopachrome tautomerase, a hypoxia-inducible factor-dependent gene, cooperates with macrophage migration inhibitory factor in renal tumorigenesis.
24353279 2014 FoxO4 interacts with the sterol regulatory factor SREBP2 and the hypoxia inducible factor HIF2? at the CYP51 promoter.
24324596 2013 Prognostic value and clinicopathological differences of HIFs in colorectal cancer: evidence from meta-analysis.
24288553 2013 Overexpression of HIF-2?, TWIST, and CXCR4 is associated with lymph node metastasis in papillary thyroid carcinoma.
24196071 2014 Hypoxia-inducible factor 2? regulates key neutrophil functions in humans, mice, and zebrafish.
24176785 2014 Regulation of the HIF-system in human macrophages--differential regulation of HIF-? subunits under sustained hypoxia.
24070809 2013 Pharmacogenetic associations with vascular endothelial growth factor inhibition in participants with neovascular age-related macular degeneration in the IVAN Study.
24041620 2013 Endothelial PAS domain protein 1 Chr2:46441523(hg18) polymorphism is associated with susceptibility to high altitude pulmonary edema in Han Chinese.
24037341 2014 Epidermal deletion of HIF-2? stimulates wound closure.
23958427 2013 Cobalt stimulates HIF-1-dependent but inhibits HIF-2-dependent gene expression in liver cancer cells.
23946285 2013 Hypoxia-inducible factor-2? and TGF-? signaling interact to promote normoxic glomerular fibrogenesis.
23940778 2013 Proteomic analysis of signaling network regulation in renal cell carcinomas with differential hypoxia-inducible factor-2? expression.
23911400 2013 Regulation of the Hif-system by micro-RNA 17 and 20a - role during monocyte-to-macrophage differentiation.
23900840 2013 Hypoxia-inducible factor-2?-dependent hypoxic induction of Wnt10b expression in adipogenic cells.
23897427 2013 BRG1 and BRM chromatin-remodeling complexes regulate the hypoxia response by acting as coactivators for a subset of hypoxia-inducible transcription factor target genes.
23886153 2013 Prognostic role of hypoxic inducible factor expression in non-small cell lung cancer: a meta-analysis.
23881929 2013 The role of aberrant VHL/HIF pathway elements in predicting clinical outcome to pazopanib therapy in patients with metastatic clear-cell renal cell carcinoma.
23873332 2013 Concerted inhibition of HIF-1? and -2? expression markedly suppresses angiogenesis in cultured RPE cells.
23852087 2013 Disulfiram deregulates HIF-? subunits and blunts tumor adaptation to hypoxia in hepatoma cells.
23840432 2013 hypoxia-inducible factors activate CD133 promoter through ETS family transcription factors.
23750001 2013 Sirtuin-7 inhibits the activity of hypoxia-inducible factors.
23716564 2013 Congenital erythrocytosis associated with gain-of-function HIF2A gene mutations and erythropoietin levels in the normal range.
23588703 2013 Expression of hypoxia-inducible factor-1? and -2? in whole-mount prostate histology: relation with dynamic contrast-enhanced MRI and Gleason score.
23563312 2013 HIF1? and HIF2? independently activate SRC to promote melanoma metastases.
23533246 2013 In vivo and in vitro oncogenic effects of HIF2A mutations in pheochromocytomas and paragangliomas.
23492195 2013 Differential regulation of pulmonary vascular cell growth by hypoxia-inducible transcription factor-1? and hypoxia-inducible transcription factor-2?.
23479510 2013 HIF2A and IGF2 expression correlates in human neuroblastoma cells and normal immature sympathetic neuroblasts.
23478175 2013 Int6/eIF3e silenced HIF2? stabilization enhances migration and tube formation of HUVECs via IL-6 and IL-8 signaling.
23473032 2013 In vivo HIF-mediated reductive carboxylation is regulated by citrate levels and sensitizes VHL-deficient cells to glutamine deprivation.
23455322 2014 Interaction between PARP-1 and HIF-2? in the hypoxic response.
23447580 2013 Activation of HIF2? in kidney proximal tubule cells causes abnormal glycogen deposition but not tumorigenesis.
23418310 2013 Tumoral EPAS1 (HIF2A) mutations explain sporadic pheochromocytoma and paraganglioma in the absence of erythrocytosis.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23378636 2013 Identification of CDCP1 as a hypoxia-inducible factor 2? (HIF-2?) target gene that is associated with survival in clear cell renal cell carcinoma patients.
23375698 2013 Clinicopathological and prognostic significance of HIF-1? and HIF-2? expression in small cell lung cancer.
23361906 2013 Novel HIF2A mutations disrupt oxygen sensing, leading to polycythemia, paragangliomas, and somatostatinomas.
23335846 2013 Lenticular cytoprotection. Part 1: the role of hypoxia inducible factors-1? and -2? and vascular endothelial growth factor in lens epithelial cell survival in hypoxia.
23334958 2013 Hypoxia promotes the production and inhibits the destruction of human articular cartilage.
23333640 2013 The inhibition of HIF-2? on the ATM/Chk-2 pathway is involved in the promotion effect of arsenite on benzo(a)pyrene-induced cell transformation.
23303559 2013 Differential regulation of HIF-mediated pathways increases mitochondrial metabolism and ATP production in hypoxic osteoclasts.
23275444 2013 Identification of the hypoxia-inducible factor 2? nuclear interactome in melanoma cells reveals master proteins involved in melanoma development.
23227185 2012 Genetic variants in EPAS1 contribute to adaptation to high-altitude hypoxia in Sherpas.
23222716 2014 MicroRNA-145 inhibits the growth, invasion, metastasis and angiogenesis of neuroblastoma cells through targeting hypoxia-inducible factor 2 alpha.
23212661 2013 Hypoxia inducible factor 2 alpha inhibits hepatocellular carcinoma growth through the transcription factor dimerization partner 3/ E2F transcription factor 1-dependent apoptotic pathway.
23194660 2013 The accumulations of HIF-1? and HIF-2? by JNK and ERK are involved in biphasic effects induced by different levels of arsenite in human bronchial epithelial cells.
23174107 2013 High aldehyde dehydrogenase activity enhances stem cell features in breast cancer cells by activating hypoxia-inducible factor-2?.
23103253 2012 HIF2? acts as an mTORC1 activator through the amino acid carrier SLC7A5.
23090011 2013 A novel EPAS1/HIF2A germline mutation in a congenital polycythemia with paraganglioma.
23063455 2013 Metabolism of kidney cancer: from the lab to clinical practice.
23042097 2013 Hypoxia-inducible factor-2? is essential in activating the COX2/mPGES-1/PGE2 signaling axis in colon cancer.
22966206 2012 Upstream stimulatory factor 2 and hypoxia-inducible factor 2? (HIF2?) cooperatively activate HIF2 target genes during hypoxia.
22931260 2012 Somatic HIF2A gain-of-function mutations in paraganglioma with polycythemia.
22894905 2012 Metabolic reprogramming and two-compartment tumor metabolism: opposing role(s) of HIF1? and HIF2? in tumor-associated fibroblasts and human breast cancer cells.
22869144 2013 Stabilization of HIF-2? through redox regulation of mTORC2 activation and initiation of mRNA translation.
22807441 2012 The acetylase/deacetylase couple CREB-binding protein/Sirtuin 1 controls hypoxia-inducible factor 2 signaling.
22684009 2012 Basal expression of copper transporter 1 in intestinal epithelial cells is regulated by hypoxia-inducible factor 2?.
22673574 2012 HIF-1? protein is upregulated in HIF-2? depleted cells via enhanced translation.
22595196 2012 EPAS1 and EGLN1 associations with high altitude sickness in Han and Tibetan Chinese at the Qinghai-Tibetan Plateau.
22537539 2013 The role of hypoxia-inducible factor-1? and -2? in androgen insensitive prostate cancer cells.
22452996 2012 Hypoxia-inducible factor-2a is associated with ABCG2 expression, histology-grade and Ki67 expression in breast invasive ductal carcinoma.
22367913 2012 Two new mutations in the HIF2A gene associated with erythrocytosis.
22277691 2012 Increased activation of the hypoxia-inducible factor pathway in varicose veins.
22247019 2012 A large-scale replication study for the association of rs17039192 in HIF-2? with knee osteoarthritis.
22113997 2012 The chromosome 2p21 region harbors a complex genetic architecture for association with risk for renal cell carcinoma.
22103974 2012 Coexpression of hypoxia-inducible factor-2?, TWIST2, and SIP1 may correlate with invasion and metastasis of salivary adenoid cystic carcinoma.
22095691 2012 C/EBP? and RUNX2 cooperate to degrade cartilage with MMP-13 as the target and HIF-2? as the inducer in chondrocytes.
22093255 2012 Hypoxia and hypoxia mimetics inhibit TNF-dependent VCAM1 induction in the 5A32 endothelial cell line via a hypoxia inducible factor dependent mechanism.
22090111 2012 Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen induction by hypoxia and hypoxia-inducible factors.
22068265 2012 Genetic determinants of Tibetan high-altitude adaptation.
21985026 2011 Hypoxia-inducible factor pathway activation in restless legs syndrome patients.
21984395 2012 Phosphorylated pVEGFR2/KDR receptor expression in uveal melanomas: relation with HIF2? and survival.
21983741 2011 [Association between diversity of hypoxia at different altitude and the polymorphism of EPAS1 gene].
21946204 2011 [Correlation between expression of HIF-2? and OCT-4 and prognosis of NSCLC].
21927022 2012 Non-canonical HIF-2? function drives autonomous breast cancer cell growth via an AREG-EGFR/ErbB4 autocrine loop.
21925595 2011 Opposite effects of HIF-1? and HIF-2? on the regulation of IL-8 expression in endothelial cells.
21888897 2011 Kelch-like 20 up-regulates the expression of hypoxia-inducible factor-2? through hypoxia- and von Hippel-Lindau tumor suppressor protein-independent regulatory mechanisms.
21869830 2012 Hypoxia-inducible factor-2? regulates Fas-mediated chondrocyte apoptosis during osteoarthritic cartilage destruction.
21841824 2012 Epigenetic regulation of HIF-1? in renal cancer cells involves HIF-1?/2? binding to a reverse hypoxia-response element.
21840298 2011 Chronic hypoxia upregulates adenosine 2a receptor expression in chromaffin cells via hypoxia inducible factor-2?: role in modulating secretion.
21718164 2011 Hypoxia: adapting to high altitude by mutating EPAS-1, the gene encoding HIF-2?.
21695080 2011 Reduced expression of fumarate hydratase in clear cell renal cancer mediates HIF-2? accumulation and promotes migration and invasion.
21637285 2011 The emerging role of hypoxia, HIF-1 and HIF-2 in multiple myeloma.
21610325 2011 Loss of either hypoxia inducible factor 1 or 2 promotes lung cancer cell colonization.
21571835 2011 Differential hypoxic regulation of hypoxia-inducible factors 1alpha and 2alpha.
21512126 2011 Coactivators necessary for transcriptional output of the hypoxia inducible factor, HIF, are directly recruited by ARNT PAS-B.
21483406 2011 Overexpression of ZNF217 in glioblastoma contributes to the maintenance of glioma stem cells regulated by hypoxia-inducible factors.
21389259 2011 Cardiopulmonary function in two human disorders of the hypoxia-inducible factor (HIF) pathway: von Hippel-Lindau disease and HIF-2alpha gain-of-function mutation.
21382346 2011 HIF-2 directly activates CD82 gene expression in endothelial cells.
21362301 2011 Correlations of hypoxia-inducible factor-1?/hypoxia-inducible factor-2? expression with angiogenesis factors expression and prognosis in non-small cell lung cancer.
21327823 2011 Association of elevated HIF-2? levels with low Beclin 1 expression and poor prognosis in patients with chondrosarcoma.
21263150 2011 Identification of HIF2alpha as an important STAT5 target gene in human hematopoietic stem cells.
21257819 2011 Mouse snail is a target gene for HIF.
21217668 2011 Replication studies in various ethnic populations do not support the association of the HIF-2? SNP rs17039192 with knee osteoarthritis.
21131975 2011 Genome-wide association study of renal cell carcinoma identifies two susceptibility loci on 2p21 and 11q13.3.
21127501 2011 Acidic stress promotes a glioma stem cell phenotype.
21109953 2011 Thymosin ?4 expression correlates with lymph node metastasis through hypoxia inducible factor-? induction in breast cancer.
21081659 2011 Combined mRNA and microRNA profiling reveals that miR-148a and miR-20b control human mesenchymal stem cell phenotype via EPAS1.
21073737 2010 Oncogenic KRAS modulates mitochondrial metabolism in human colon cancer cells by inducing HIF-1? and HIF-2? target genes.
21057546 2011 Opposite functions of HIF-? isoforms in VEGF induction by TGF-?1 under non-hypoxic conditions.
21042786 2010 The relationship of erythropoietin overexpression with von Hippel-Lindau tumour suppressor gene mutations between hypoxia-inducible factor-1? and -2? in sporadic clear cell renal carcinoma.
21030426 2011 Genetic variations in Tibetan populations and high-altitude adaptation at the Himalayas.
20978319 2010 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
20965423 2010 Hypoxia-inducible factors and the response to hypoxic stress.
20964835 2010 The VHL-dependent regulation of microRNAs in renal cancer.
20961960 2011 A genome-wide search for signals of high-altitude adaptation in Tibetans.
20939709 2011 The HIF pathway and erythrocytosis.
20856199 2011 Prolyl-4-hydroxylase PHD2- and hypoxia-inducible factor 2-dependent regulation of amphiregulin contributes to breast tumorigenesis.
20824203 2010 EMMPRIN promotes melanoma cells malignant properties through a HIF-2alpha mediated up-regulation of VEGF-receptor-2.
20807755 2010 Hypoxia inducible factor 1? and hypoxia inducible factor 2? play distinct and functionally overlapping roles in oral squamous cell carcinoma.
20632821 2010 Pathogenic mechanisms in varicose vein disease: the role of hypoxia and inflammation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595611 2010 Sequencing of 50 human exomes reveals adaptation to high altitude.
20559438 2010 HIF-1alpha and HIF-2alpha are differentially activated in distinct cell populations in retinal ischaemia.
20559021 2010 HIF-1? and HIF-2? correlate with migration and invasion in gastric cancer.
20551700 2010 Effect of oxygen on the expression of hypoxia-inducible factors in human fetal lung explants.
20534544 2010 Natural selection on EPAS1 (HIF2alpha) associated with low hemoglobin concentration in Tibetan highlanders.
20513003 2010 Roles of hypoxia-inducible factor-1alpha (HIF-1alpha) versus HIF-2alpha in the survival of hepatocellular tumor spheroids.
20496369 2010 Hypoxia-inducible factor regulation of ANK expression in nucleus pulposus cells: possible implications in controlling dystrophic mineralization in the intervertebral disc.
20416395 2010 Hypoxia-inducible factor (HIF)-3alpha is subject to extensive alternative splicing in human tissues and cancer cells and is regulated by HIF-1 but not HIF-2.
20395290 2010 HIF-2alpha-mediated activation of the epidermal growth factor receptor potentiates head and neck cancer cell migration in response to hypoxia.
20375133 2010 A hypoxic niche regulates glioblastoma stem cells through hypoxia inducible factor 2 alpha.
20354189 2010 The connectivity map links iron regulatory protein-1-mediated inhibition of hypoxia-inducible factor-2a translation to the anti-inflammatory 15-deoxy-delta12,14-prostaglandin J2.
20304964 2010 The NADPH oxidase subunit p22phox inhibits the function of the tumor suppressor protein tuberin.
20224786 2010 Characterization of the activation of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) by hypoxia inducible factor-2 alpha.
20204822 2010 HIF-mediated hypoxic response is missing in severely hypoxic uterine leiomyomas.
20158574 2010 Inter-connection between mitochondria and HIFs.
20039838 2010 The hypoxia-inducible factor-2alpha is stabilized by oxidative stress involving NOX4.
20032376 2009 Mutation analysis of hypoxia-inducible factors HIF1A and HIF2A in renal cell carcinoma.
20028863 2010 Prolyl hydroxylases 2 and 3 act in gliomas as protective negative feedback regulators of hypoxia-inducible factors.
20015878 2010 Hypoxia-inducible factor-2 is a novel regulator of aberrant CXCL12 expression in multiple myeloma plasma cells.
19955413 2009 Human cancers converge at the HIF-2alpha oncogenic axis.
19940151 2010 Hsp70 and CHIP selectively mediate ubiquitination and degradation of hypoxia-inducible factor (HIF)-1alpha but Not HIF-2alpha.
19914104 Expression of hypoxia inducible factor-1? and 2? in conventional renal cell carcinoma with or without sarcomatoid differentiation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903792 2009 HIF-1alpha and HIF-2alpha are differentially regulated in vivo in neuroblastoma: high HIF-1alpha correlates negatively to advanced clinical stage and tumor vascularization.
19837976 2009 EMMPRIN promotes angiogenesis through hypoxia-inducible factor-2alpha-mediated regulation of soluble VEGF isoforms and their receptor VEGFR-2.
19805377 2009 HIF-2alpha maintains an undifferentiated state in neural crest-like human neuroblastoma tumor-initiating cells.
19706526 2009 HIF2alpha inhibition promotes p53 pathway activity, tumor cell death, and radiation responses.
19660915 2009 Expression of hypoxia-inducible factor-1alpha and hypoxia-inducible factor-2alpha with progression of keratinocytic neoplasms.
19590888 2009 Expression of hypoxia-inducible factor-1alpha and -2alpha in human choroidal neovascular membranes.
19541651 2009 Adenosine A2A receptor is a unique angiogenic target of HIF-2alpha in pulmonary endothelial cells.
19498162 2009 Regulation of hypoxia-inducible factor 2alpha signaling by the stress-responsive deacetylase sirtuin 1.
19483472 2009 PTEN suppression of YY1 induces HIF-2 activity in von-Hippel-Lindau-null renal-cell carcinoma.
19477429 2009 Hypoxia-inducible factors regulate tumorigenic capacity of glioma stem cells.
19436307 2009 Hypoxia-inducible factor-1alpha and -2alpha are expressed in most rectal cancers but only hypoxia-inducible factor-1alpha is associated with prognosis.
19401348 2009 Loss of VHL and hypoxia provokes PAX2 up-regulation in clear cell renal cell carcinoma.
19386601 2009 Genome-wide association of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha DNA binding with expression profiling of hypoxia-inducible transcripts.
19322701 2009 Hypoxia-inducible factor-2alpha mRNA expression in human renal cell carcinoma.
19287200 2009 Regulation of glucose metabolism-related genes and VEGF by HIF-1alpha and HIF-1beta, but not HIF-2alpha, in gastric cancer.
19252526 2009 VHL Type 2B gene mutation moderates HIF dosage in vitro and in vivo.
19238077 2009 Pancreatic endocrine microadenomatosis in patients with von Hippel-Lindau disease: characterization by VHL/HIF pathway proteins expression.
19208626 2009 Erythrocytosis-associated HIF-2alpha mutations demonstrate a critical role for residues C-terminal to the hydroxylacceptor proline.
19129502 2009 Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
19080330 2008 Effect of endothelial PAS domain protein 1 and hypoxia inducible factor 1alpha on vascular endothelial growth factor expression in human pancreatic carcinoma.
19077391 2009 Hypoxia-inducible factor-1alpha and -2alpha additively promote endothelial vasculogenic properties.
19030186 2009 HIF-1alpha and HIF-2alpha have divergent roles in colon cancer.
19021062 2008 Lactate dehydrogenase 5 expression in non-Hodgkin B-cell lymphomas is associated with hypoxia regulated proteins.
19010893 2008 Hypoxia-inducible factor-2alpha correlates to distant recurrence and poor outcome in invasive breast cancer.
18957292 2008 A reducing environment stabilizes HIF-2alpha in SH-SY5Y cells under hypoxic conditions.
18945681 2008 Differential dependence of hypoxia-inducible factors 1 alpha and 2 alpha on mTORC1 and mTORC2.
18787502 2009 Genetic contributions to the development of retinopathy of prematurity.
18728663 2008 Poorer outcome in stromal HIF-2 alpha- and CA9-positive colorectal adenocarcinomas is associated with wild-type TP53 but not with BNIP3 promoter hypermethylation or apoptosis.
18711622 2008 Familial erythrocytosis arising from a gain-of-function mutation in the HIF2A gene of the oxygen sensing pathway.
18650473 2008 Autosomal dominant erythrocytosis and pulmonary arterial hypertension associated with an activating HIF2 alpha mutation.
18625704 2008 Activation of the VEGFR1 chromatin domain: an angiogenic signal-ETS1/HIF-2alpha regulatory axis.
18508787 2008 A novel heterozygous HIF2AM535I mutation reinforces the role of oxygen sensing pathway disturbances in the pathogenesis of familial erythrocytosis.
18442887 2008 Analysis of the Runx2 promoter in osseous and non-osseous cells and identification of HIF2A as a potent transcription activator.
18423372 2008 Heterogeneity in binding and gene-expression regulation by HIF-2alpha.
18420194 2008 The specific contribution of hypoxia-inducible factor-2alpha to hypoxic gene expression in vitro is limited and modulated by cell type-specific and exogenous factors.
18378852 2008 Novel exon 12 mutations in the HIF2A gene associated with erythrocytosis.
18319549 2008 Prognostic significance of HIF-2alpha expression on tumor infiltrating macrophages in patients with uterine cervical cancer undergoing radiotherapy.
18184961 2008 A gain-of-function mutation in the HIF2A gene in familial erythrocytosis.
18077449 2008 Hypoxia promotes the differentiated human articular chondrocyte phenotype through SOX9-dependent and -independent pathways.
18055454 2008 Sphingosine kinase 1 is up-regulated during hypoxia in U87MG glioma cells. Role of hypoxia-inducible factors 1 and 2.
18024825 2007 Expression of hypoxia-inducible factor 1alpha and 2alpha in choroidal neovascular membranes associated with age-related macular degeneration.
18000879 2008 Novel interaction partners of Bardet-Biedl syndrome proteins.
17907154 2007 Hypoxia-inducible factor 2alpha is essential for hypoxic induction of the human articular chondrocyte phenotype.
17852557 2008 Hypoxia inducible factor (HIf1alpha and HIF2alpha) and carbonic anhydrase 9 (CA9) expression and response of head-neck cancer to hypofractionated and accelerated radiotherapy.
17718430 2007 [Expression of HIF-1alpha mRNA and HIF-2alpha mRNA in placentas of pregnant women with intrahepatic cholestasis of pregnancy].
17570486 2007 Role of hypoxia-inducible transcription factors 1alpha and 2alpha in the regulation of plasminogen activator inhibitor-1 expression in a human trophoblast cell line.
17562539 2007 Localization of immunoreactive HIF-1alpha and HIF-2alpha in neuroendocrine cells of both benign and malignant prostate glands.
17555795 2007 Expression of hypoxia-inducible factor 1alpha, hypoxia-inducible factor 2alpha, and von Hippel-Lindau protein in epithelial ovarian neoplasms and allelic loss of von Hippel-Lindau gene: nuclear expression of hypoxia-inducible factor 1alpha is an independent prognostic factor in ovarian carcinoma.
17526729 2007 Hypoxia-inducible factor linked to differential kidney cancer risk seen with type 2A and type 2B VHL mutations.
17495954 2007 Upregulation of hypoxia-inducible factors in normal and psoriatic skin.
17477366 2007 Expression of the forkhead transcription factor FOXP1 is associated both with hypoxia inducible factors (HIFs) and the androgen receptor in prostate cancer but is not directly regulated by androgens or hypoxia.
17452775 2007 Stromal expression of hypoxia regulated proteins is an adverse prognostic factor in colorectal carcinomas.
17437013 2007 Increasing expression of hypoxia-inducible proteins in the Barrett's metaplasia-dysplasia-adenocarcinoma sequence.
17418410 2007 HIF-2alpha promotes hypoxic cell proliferation by enhancing c-myc transcriptional activity.
17417656 2007 Iron-regulatory proteins limit hypoxia-inducible factor-2alpha expression in iron deficiency.
17353276 2007 The peptidyl prolyl cis/trans isomerase FKBP38 determines hypoxia-inducible transcription factor prolyl-4-hydroxylase PHD2 protein stability.
17324924 2007 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation.
17285230 2007 Prognostic significance of co-overexpression of the EGFR/IGFBP-2/HIF-2A genes in astrocytomas.
17220275 2007 The hypoxia-inducible factor 2alpha N-terminal and C-terminal transactivation domains cooperate to promote renal tumorigenesis in vivo.
17140440 2006 Tumor cell invasion of von Hippel Lindau renal cell carcinoma cells is mediated by membrane type-1 matrix metalloproteinase.
17097563 2006 Recruitment of HIF-1alpha and HIF-2alpha to common target genes is differentially regulated in neuroblastoma: HIF-2alpha promotes an aggressive phenotype.
17024177 2006 The phosphorylation status of PAS-B distinguishes HIF-1alpha from HIF-2alpha in NBS1 repression.
16920734 2007 Renal cancer cells lacking hypoxia inducible factor (HIF)-1alpha expression maintain vascular endothelial growth factor expression through HIF-2alpha.
16885164 2006 The length of peptide substrates has a marked effect on hydroxylation by the hypoxia-inducible factor prolyl 4-hydroxylases.
16826581 2006 The relation between hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha expression with anemia and outcome in surgically treated head and neck cancer.
16760477 2006 Cell-specific regulation of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha stabilization and transactivation in a graded oxygen environment.
16554418 2006 Hypoxia-inducible factors in the kidney.
16284786 2006 Regular endurance training reduces the exercise induced HIF-1alpha and HIF-2alpha mRNA expression in human skeletal muscle in normoxic conditions.
16278385 2005 The androgen receptor is significantly associated with vascular endothelial growth factor and hypoxia sensing via hypoxia-inducible factors HIF-1a, HIF-2a, and the prolyl hydroxylases in human prostate cancer.
16263938 2006 Impact of HIF-1alpha and HIF-2alpha on proliferation and migration of human pulmonary artery fibroblasts in hypoxia.
16208515 2005 The EPAS1 gene influences the aerobic-anaerobic contribution in elite endurance athletes.
16098466 2005 Genetic evidence for a tumor suppressor role of HIF-2alpha.
15964822 2005 Contrasting properties of hypoxia-inducible factor 1 (HIF-1) and HIF-2 in von Hippel-Lindau-associated renal cell carcinoma.
15653678 2005 Activity of hypoxia-inducible factor 2alpha is regulated by association with the NF-kappaB essential modulator.
15652356 2005 HIF-2alpha expression in human fetal paraganglia and neuroblastoma: relation to sympathetic differentiation, glucose deficiency, and hypoxia.
15598469 2005 The hypoxia-inducible factor and tumor progression along the angiogenic pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15261140 2004 Small molecule blockade of transcriptional coactivation of the hypoxia-inducible factor pathway.
15247232 2004 Differential function of the prolyl hydroxylases PHD1, PHD2, and PHD3 in the regulation of hypoxia-inducible factor.
15240563 2004 Differentiating the functional role of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha (EPAS-1) by the use of RNA interference: erythropoietin is a HIF-2alpha target gene in Hep3B and Kelly cells.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15217953 2004 Effect of radiation and ibuprofen on normoxic renal carcinoma cells overexpressing hypoxia-inducible factors by loss of von Hippel-Lindau tumor suppressor gene function.
15192019 2004 Endothelial PAS domain protein 1 gene promotes angiogenesis through the transactivation of both vascular endothelial growth factor and its receptor, Flt-1.
15156561 2004 Regulation of HIF prolyl hydroxylases by hypoxia-inducible factors.
15039136 2004 The PAI-1 gene as a direct target of endothelial PAS domain protein-1 in adenocarcinoma A549 cells.
14985465 2004 Inhibition of hypoxia-inducible factor is sufficient for growth suppression of VHL-/- tumors.
14966910 2004 Expression of HIF-2alpha/EPAS1 in hepatocellular carcinoma.
14744852 2004 Prolonged hypoxia differentially regulates hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha expression in lung epithelial cells: implication of natural antisense HIF-1alpha.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691554 2003 Inhibition of HIF2alpha is sufficient to suppress pVHL-defective tumor growth.
14668441 2003 Structural basis for PAS domain heterodimerization in the basic helix--loop--helix-PAS transcription factor hypoxia-inducible factor.
14645546 2003 Differential roles of hypoxia-inducible factor 1alpha (HIF-1alpha) and HIF-2alpha in hypoxic gene regulation.
14512791 2003 Hypoxia-inducible factors 1alpha and 2alpha are related to vascular endothelial growth factor expression and a poorer prognosis in nodular malignant melanomas of the skin.
12823854 2003 Upregulated hypoxia inducible factor-1alpha and -2alpha pathway in rheumatoid arthritis and osteoarthritis.
12697324 2003 HIF-2alpha regulates glyceraldehyde-3-phosphate dehydrogenase expression in endothelial cells.
12588875 2003 MAPK signaling up-regulates the activity of hypoxia-inducible factors by its effects on p300.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464608 2003 Cooperative interaction of hypoxia-inducible factor-2alpha (HIF-2alpha ) and Ets-1 in the transcriptional activation of vascular endothelial growth factor receptor-2 (Flk-1).
12209691 2002 Association of hypoxia-inducible factors 1alpha and 2alpha with activated angiogenic pathways and prognosis in patients with endometrial carcinoma.
12123724 2002 Regulation of the HIF pathway: enzymatic hydroxylation of a conserved prolyl residue in hypoxia-inducible factor alpha subunits governs capture by the pVHL E3 ubiquitin ligase complex.
11823643 2002 Asparagine hydroxylation of the HIF transactivation domain a hypoxic switch.
11782478 2002 Differential activities of murine single minded 1 (SIM1) and SIM2 on a hypoxic response element. Cross-talk between basic helix-loop-helix/per-Arnt-Sim homology transcription factors.
11573933 2001 Expression and characterization of hypoxia-inducible factor (HIF)-3alpha in human kidney: suppression of HIF-mediated gene expression by HIF-3alpha.
11313887 2001 A variant of nuclear localization signal of bipartite-type is required for the nuclear translocation of hypoxia inducible factors (1alpha, 2alpha and 3alpha).
11018023 2000 CLIF, a novel cycle-like factor, regulates the circadian oscillation of plasminogen activator inhibitor-1 gene expression.
10823831 2000 Hypoxia inducible factor-alpha binding and ubiquitylation by the von Hippel-Lindau tumor suppressor protein.
10202154 1999 Molecular mechanisms of transcription activation by HLF and HIF1alpha in response to hypoxia: their stabilization and redox signal-induced interaction with CBP/p300.
9576906 1998 The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.
9110174 1997 Large-scale concatenation cDNA sequencing.
9079689 1997 Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.
9000051 1997 Endothelial PAS domain protein 1 (EPAS1), a transcription factor selectively expressed in endothelial cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.