Property Summary

NCBI Gene PubMed Count 33
PubMed Score 26.70
PubTator Score 65.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.400 8.9e-03
osteosarcoma -1.511 1.8e-05
sonic hedgehog group medulloblastoma 1.600 4.8e-06
intraductal papillary-mucinous adenoma (... 1.400 1.7e-02
intraductal papillary-mucinous carcinoma... 1.200 4.1e-02
lung cancer 1.400 2.4e-02
ovarian cancer 2.200 1.0e-04

Protein-protein Interaction (5)

Gene RIF (17)

PMID Text
26669263 EP400 deposits H3.3 into chromatin alongside H2AZ and contributes to gene regulation after Pol II pre-initiation complex assembly.
26578561 All together these results show that p400 acts as a brake to prevent alternative End Joining-dependent genetic instability and underline its potential value as a clinical marker.
24332572 Data indicate that three genes, namely Chemokine (C-X-C motif) receptor 2 (CXCR2), C-C chemokine receptor type 2 (CCR2) and E1A-Binding Protein P400 (EP400), were able to identify HCC individually with accuracies of 82.4%, 78.4% and 65%, respectively.
23982490 Our data suggest that the highly proliferative, decreased-p400 subgroup of renal cell carcinomas represents tumors that are characterized by a loss of the tumor-suppressive mechanism of senescence.
23266955 The p400 ATPase is required for DNA repair by homologous recombination.
23146670 age-dependent p400 downregulation and loss of H2A.Z localisation may contribute to the onset of replicative senescence through a sustained high rate of p21 transcription
23064015 incorporation of the histone variant H2A.Z at the promoter regions of PPARgamma target genes by p400/Brd8 is essential to allow fat cell differentiation
20876283 p400 is a novel DNA damage response protein and p400-mediated alterations in nucleosome and chromatin structure promote both chromatin ubiquitination and the accumulation of brca1 and 53BP1 at sites of DNA damage.
20548951 Depletion of p400 indeed increases intracellular reactive oxygen species levels and causes the appearance of DNA damage
20351180 Results suggest that p400 represses basal p21 gene expression through dual mechanisms that include direct inhibition of TIP60 and ATP-dependent positioning of H2A.Z at the promoter.
19454010 The core of the p400/TRRAP complex, consists of BAF53A, P400, RUVBL1, RUVBL2, TRRAP, are identified to interact with HIV-1 Tat in Jurkat cell
19169279 p400/Tip60 ratio is critical for colon cancer cells proliferation and response to therapeutic drugs through the control of stress-response pathways.
18985155 Myc recruits the Tip60/p400 complex to achieve a coordinated histone acetylation/exchange reaction at activated promoters.
18413597 These findings establish that Myc, via p400, is an essential downstream target of adenovirus E1A.
16601686 Tip60 and p400 play distinct roles in DNA damage-induced apoptosis and underline the importance of the Tip60 complex and its regulation in the proper control of cell fate.
15741165 p400 is a regulator of the ARF-p53 pathway and a component of the cellular machinery that couples proliferation to cell death
15655109 p400 is a component of the p53-p21(WAF1/CIP1/sid1) pathway, regulating the p21 transcription and cell senescence induction program.

AA Sequence

MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQLMNRSPATGQ      1 - 70
NVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPS     71 - 140
PGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQ    141 - 210
HPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQ    211 - 280
QVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPGLSSLPLTSVGNTGMKKVPKK    281 - 350
LEEIPPASPEMAQMRKQCLDYHYQEMQALKEVFKEYLIELFFLQHFQGNMMDFLAFKKKHYAPLQAYLRQ    351 - 420
NDLDIEEEEEEEEEEEEKSEVINDEVKVVTGKDGQTGTPVAIATQLPPKVSAAFSSQQQPFQQALAGSLV    421 - 490
AGAGSTVETDLFKRQQAMPSTGMAEQSKRPRLEVGHQGVVFQHPGADAGVPLQQLMPTAQGGMPPTPQAA    491 - 560
QLAGQRQSQQQYDPSTGPPVQNAASLHTPLPQLPGRLPPAGVPTAALSSALQFAQQPQVVEAQTQLQIPV    561 - 630
KTQQPNVPIPAPPSSQLPIPPSQPAQLALHVPTPGKVQVQASQLSSLPQMVASTRLPVDPAPPCPRPLPT    631 - 700
SSTSSLAPVSGSGPGPSPARSSPVNRPSSATNKALSPVTSRTPGVVASAPTKPQSPAQNATSSQDSSQDT    701 - 770
LTEQITLENQVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKL    771 - 840
VRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQVVEIKLRVELEEKRKKALNLQKVS    841 - 910
RRGKELRPKGFDALQESSLDSGMSGRKRKASISLTDDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAE    911 - 980
LPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIG    981 - 1050
KPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSLLYGALRDYQKIGLDWLAKLYRKNLNGILADEAGL   1051 - 1120
GKTVQIIAFFAHLACNEGNWGPHLVVVRSCNILKWELELKRWCPGLKILSYIGSHRELKAKRQEWAEPNS   1121 - 1190
FHVCITSYTQFFRGLTAFTRVRWKCLVIDEMQRVKGMTERHWEAVFTLQSQQRLLLIDSPLHNTFLELWT   1191 - 1260
MVHFLVPGISRPYLSSPLRAPSEESQDYYHKVVIRLHRVTQPFILRRTKRDVEKQLTKKYEHVLKCRLSN   1261 - 1330
RQKALYEDVILQPGTQEALKSGHFVNVLSILVRLQRICNHPGLVEPRHPGSSYVAGPLEYPSASLILKAL   1331 - 1400
ERDFWKEADLSMFDLIGLENKITRHEAELLSKKKIPRKLMEEISTSAAPAARPAAAKLKASRLFQPVQYG   1401 - 1470
QKPEGRTVAFPSTHPPRTAAPTTASAAPQGPLRGRPPIATFSANPEAKAAAAPFQTSQASASAPRHQPAS   1471 - 1540
ASSTAASPAHPAKLRAQTTAQASTPGQPPPQPQAPSHAAGQSALPQRLVLPSQAQARLPSGEVVKIAQLA   1541 - 1610
SITGPQSRVAQPETPVTLQFQGSKFTLSHSQLRQLTAGQPLQLQGSVLQIVSAPGQPYLRAPGPVVMQTV   1611 - 1680
SQAGAVHGALGSKPPAGGPSPAPLTPQVGVPGRVAVNALAVGEPGTASKPASPIGGPTQEEKTRLLKERL   1681 - 1750
DQIYLVNERRCSQAPVYGRDLLRICALPSHGRVQWRGSLDGRRGKEAGPAHSYTSSSESPSELMLTLCRC   1751 - 1820
GESLQDVIDRVAFVIPPVVAAPPSLRVPRPPPLYSHRMRILRQGLREHAAPYFQQLRQTTAPRLLQFPEL   1821 - 1890
RLVQFDSGKLEALAILLQKLKSEGRRVLILSQMILMLDILEMFLNFHYLTYVRIDENASSEQRQELMRSF   1891 - 1960
NRDRRIFCAILSTHSRTTGINLVEADTVVFYDNDLNPVMDAKAQEWCDRIGRCKDIHIYRLVSGNSIEEK   1961 - 2030
LLKNGTKDLIREVAAQGNDYSMAFLTQRTIQELFEVYSPMDDAGFPVKAEEFVVLSQEPSVTETIAPKIA   2031 - 2100
RPFIEALKSIEYLEEDAQKSAQEGVLGPHTDALSSDSENMPCDEEPSQLEELADFMEQLTPIEKYALNYL   2101 - 2170
ELFHTSIEQEKERNSEDAVMTAVRAWEFWNLKTLQEREARLRLEQEEAELLTYTREDAYSMEYVYEDVDG   2171 - 2240
QTEVMPLWTPPTPPQDDSDIYLDSVMCLMYEATPIPEAKLPPVYVRKERKRHKTDPSAAGRKKKQRHGEA   2241 - 2310
VVPPRSLFDRATPGLLKIRREGKEQKKNILLKQQVPFAKPLPTFAKPTAEPGQDNPEWLISEDWALLQAV   2311 - 2380
KQLLELPLNLTIVSPAHTPNWDLVSDVVNSCSRIYRSSKQCRNRYENVIIPREEGKSKNNRPLRTSQIYA   2381 - 2450
QDENATHTQLYTSHFDLMKMTAGKRSPPIKPLLGMNPFQKNPKHASVLAESGINYDKPLPPIQVASLRAE   2451 - 2520
RIAKEKKALADQQKAQQPAVAQPPPPQPQPPPPPQQPPPPLPQPQAAGSQPPAGPPAVQPQPQPQPQTQP   2521 - 2590
QPVQAPAKAQPAITTGGSAAVLAGTIKTSVTGTSMPTGAVSGNVIVNTIAGVPAATFQSINKRLASPVAP   2591 - 2660
GALTTPGGSAPAQVVHTQPPPRAVGSPATATPDLVSMATTQGVRAVTSVTASAVVTTNLTPVQTPARSLV   2661 - 2730
PQVSQATGVQLPGKTITPAHFQLLRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTTTTSQVQVPQIQGQA   2731 - 2800
QSPAQIKAVGKLTPEHLIKMQKQKLQMPPQPPPPQAQSAPPQPTAQVQVQTSQPPQQQSPQLTTVTAPRP   2801 - 2870
GALLTGTTVANLQVARLTRVPTSQLQAQGQMQTQAPQPAQVALAKPPVVSVPAAVVSSPGVTTLPMNVAG   2871 - 2940
ISVAIGQPQKAAGQTVVAQPVHMQQLLKLKQQAVQQQKAIQPQAAQGPAAVQQKITAQQITTPGAQQKVA   2941 - 3010
YAAQPALKTQFLTTPISQAQKLAGAQQVQTQIQVAKLPQVVQQQTPVASIQQVASASQQASPQTVALTQA   3011 - 3080
TAAGQQVQMIPAVTATAQVVQQKLIQQQVVTTASAPLQTPGAPNPAQVPASSDSPSQQPKLQMRVPAVRL   3081 - 3150
KTPTKPPCQ                                                                3151 - 3159
//

Text Mined References (45)

PMID Year Title
26669263 2016 EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation.
26578561 2016 Control of alternative end joining by the chromatin remodeler p400 ATPase.
25416956 2014 A proteome-scale map of the human interactome network.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24332572 2014 A blood-based three-gene signature for the non-invasive detection of early human hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23982490 2013 Senescence-associated protein p400 is a prognostic marker in renal cell carcinoma.
23266955 2012 The chromatin remodeler p400 ATPase facilitates Rad51-mediated repair of DNA double-strand breaks.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146670 Decrease of p400 ATPase complex and loss of H2A.Z within the p21 promoter occur in senescent IMR-90 human fibroblasts.
23064015 2012 The p400/Brd8 chromatin remodeling complex promotes adipogenesis by incorporating histone variant H2A.Z at PPAR? target genes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21320693 2011 Antiviral inhibition targeting the HCMV kinase pUL97 requires pUL27-dependent degradation of Tip60 acetyltransferase and cell-cycle arrest.
21269460 2011 Initial characterization of the human central proteome.
20876283 2010 The p400 ATPase regulates nucleosome stability and chromatin ubiquitination during DNA repair.
20548951 2010 The E1A-associated p400 protein modulates cell fate decisions by the regulation of ROS homeostasis.
20351180 2010 The SANT domain of p400 ATPase represses acetyltransferase activity and coactivator function of TIP60 in basal p21 gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19169279 2009 The p400/Tip60 ratio is critical for colorectal cancer cell proliferation through DNA damage response pathways.
18985155 2008 Analysis of Myc-induced histone modifications on target chromatin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18413597 2008 Adenovirus E1A targets p400 to induce the cellular oncoprotein Myc.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16601686 2006 Tip60 and p400 are both required for UV-induced apoptosis but play antagonistic roles in cell cycle progression.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15741165 2005 p400 is required for E1A to promote apoptosis.
15655109 2005 The p400 E1A-associated protein is a novel component of the p53 --> p21 senescence pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12693553 2003 Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509179 2001 The p400 complex is an essential E1A transformation target.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.