Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.64
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.489 9.1e-09
Breast cancer -2.600 3.4e-31
breast carcinoma -1.400 1.5e-26
dermatomyositis 1.400 2.2e-03
fascioscapulohumeral muscular dystrophy 1.007 4.9e-04
gastric carcinoma 1.800 6.2e-03
group 3 medulloblastoma 2.300 5.7e-04
invasive ductal carcinoma -1.700 8.0e-04
lung adenocarcinoma -1.100 9.7e-13
lung cancer -2.400 1.7e-04
lung carcinoma -1.100 2.1e-15
malignant mesothelioma -2.800 2.1e-07
ovarian cancer -2.100 6.2e-10
psoriasis -1.200 4.1e-06

Gene RIF (4)

AA Sequence

MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYK      1 - 70
KHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKET     71 - 140
SDSSLVCSRYLQYCRATNLYLDLRNIKRNHDRFKEDFFQSGEIGGHCKLDIRTLTSEGQRKSPLQSWFAE    141 - 210
LQSYTQLNFRPIEDAKCDIVIEKPTYFMKLDAGVNMYHHFCDFINLYITQHVNNSFSTDVYIVMWDTSSY    211 - 280
GYGDLFSDTWNAFTDYDVIHLKTYDSKRVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFAQHVL    281 - 350
HRLNITQEGPKDGKIRVTILARSTEYRKILNQNELVNALKTVSTFEVQIVDYKYRELGFLDQLRITHNTD    351 - 420
IFIGMHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGVHYITWRRQNKVFPQDKGHHPTLGEHPK    421 - 490
FTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL                                     491 - 527
//

Text Mined References (16)

PMID Year Title