Property Summary

NCBI Gene PubMed Count 6
PubMed Score 78.35
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3098 1.0e-06
ovarian cancer 8491 2.5e-04
lung cancer 4473 5.9e-04
Disease Target Count Z-score Confidence
Warsaw breakage syndrome 12 4.043 2.0
Spinocerebellar ataxia type 7 13 3.13 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 5.9e-04
Breast cancer 1.500 1.0e-06
ovarian cancer 1.500 2.5e-04

Gene RIF (1)

PMID Text
18206972 ATXN7L3, USP22, & ENY2 are required cofactors for full transcriptional activity by nuclear receptors. The deubiquitinase activity of TFTC/STAGA HAT counteracts heterochromatin silencing & is a positive cofactor for in vivo nuclear receptor activation.

AA Sequence

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE      1 - 70
ITPKGRALVPDSVKKELLQRIRTFLAQHASL                                            71 - 101
//

Text Mined References (12)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21746879 2011 The tightly controlled deubiquitination activity of the human SAGA complex differentially modifies distinct gene regulatory elements.
21269460 2011 Initial characterization of the human central proteome.
18206972 2008 A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11438676 2001 The novel transcription factor e(y)2 interacts with TAF(II)40 and potentiates transcription activation on chromatin templates.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.